Diaphorina citri psyllid: psy1366


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCGSPSSCDGTNFSPVTSVDQDNYKDYQEIKIQERAAGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAESHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRENGEWHLEAGALVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTISVAKDKESKKVKVKS
ccccccccccccccccccccEEEEEEEEEEccccEEEEEEEEEEccccccEEEEECccccccccccccccccccccccccccEEEEccccEEECcEEEEEEcccccccccccCEEEEEEcccccccccccEEEEEEEEEcccccccccccccEEEEEEEEEEEECccccccccccHHHHHHHHHHHHccccccHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccEEcccccEEEEcccccHHHHHHHHHHHHcccEEEEccccccccccEEEEEEEcccEEEccEEEEEEcccEEEcccccccccccHHHHHHHHccccHHEEEccEEEEccccc
LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCG***************VDQDNYKDYQEIKIQERAAGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAESHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRENGEWHLEAGALVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTISVAKDKESKKVK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCGSPSSCDGTNFSPVTSVDQDNYKDYQEIKIQERAAGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAESHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRENGEWHLEAGALVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTISVAKDKESKKVKVKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA helicase MCM9 confidentQ9NXL9
DNA helicase MCM9 Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart. In eggs, required for MCM2-7 loading onto chromatin during DNA replication. Probably not required for DNA replication in other cells.confidentF6RIX4
DNA helicase MCM9 Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart.confidentF1M5F3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0030174 [BP]regulation of DNA-dependent DNA replication initiationprobableGO:0009889, GO:0051052, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:2000112, GO:0006275, GO:0050794, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:0008150, GO:0090329, GO:0050789, GO:0080090
GO:0042555 [CC]MCM complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0005656 [CC]pre-replicative complexprobableGO:0036387, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0032991, GO:0043231, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0043142 [MF]single-stranded DNA-dependent ATPase activityprobableGO:0008094, GO:0016818, GO:0042623, GO:0016787, GO:0017111, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0016887
GO:0043140 [MF]ATP-dependent 3'-5' DNA helicase activityprobableGO:0008094, GO:0016818, GO:0016462, GO:0008026, GO:0042623, GO:0004003, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003674, GO:0016887, GO:0003678, GO:0043138, GO:0003824
GO:0031298 [CC]replication fork protection complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005657, GO:0005694, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0043596, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0006268 [BP]DNA unwinding involved in replicationprobableGO:0071103, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0032392, GO:0006139, GO:0032508, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0003688 [MF]DNA replication origin bindingprobableGO:0043565, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F9V, chain A
Confidence level:very confident
Coverage over the Query: 6-344
View the alignment between query and template
View the model in PyMOL