Psyllid ID: psy1366


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCGSPSSCDGTNFSPVTSVDQDNYKDYQEIKIQERAAGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAESHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRENGEWHLEAGALVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTISVAKDKESKKVKVKS
ccccccccccccccccccccEEEEEEEEEEccccEEEEEEEEEEccccccEEEEEEccccccccccccccccccccccccccEEEEccccEEEEcEEEEEEcccccccccccEEEEEEEcccccccccccEEEEEEEEEcccccccccccccEEEEEEEEEEEEEccccccccccHHHHHHHHHHHHccccccHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccEEcccccEEEEcccccHHHHHHHHHHHHcccEEEEccccccccccEEEEEEEcccEEEccEEEEEEcccEEEcccccccccccHHHHHHHHccccHHEEEccEEEEccccc
cccccEEEcHcHccHHHHccEEEEEEEEEEEcccccEEEEEEEEcccccEEEEEccccccccccccccccccccccccccccEEEEcccEEEEccEEEEEEEcccccccccccEEEEEccHHHHccccccEEEEEEEEEcccccccccccccEEEEEEHHHHEcccHHHccccccHHHHHHHHHHHcccccccHHHHHHHHHHHccHHccHHHHHHHHHHHHHcccccccccccEEEccEEEEEEccccHHHHHHHHHHHHHcccEEEEccccccccEEEEEEEcccccEEEEHHHHHEHcccEEEEEcHccccHHHHHHHHHHHHHccEEHHHccEEEEEcccc
lpicpqlhrtqfpnnedigslLQISGTVVRITVAKMLEFRREYVCtkckqcfyvkadfeqfysianplscgspsscdgtnfspvtsvdqdnykdYQEIKIQeraagvgsvpksIWVTLEDdlvdlarpgddvivCGAVLRRWRPVVKGVRSDIELCLSANyltvcndqssslvitpeLRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAggvgrggedgskvrAESHLllvgdpgtgkSEILKFAkrmsprsvlttgvgtttAGLTVSALRENGEWHLEAGALVLsdggvccidefssikehdrtSIHEAMEQQTISVAKdkeskkvkvks
lpicpqlhrtqfpnnedigsllqisgTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCGSPSSCDGTNFSPVTSVDQDNYKDYQEIKIqeraagvgsvpkSIWVTLEDDLVDLARPGDDVIvcgavlrrwrpvvkGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAEshlllvgdpgtgKSEILKfakrmsprsvlttgvgtttaGLTVSALRENGEWHLEAGALVLSDGGVCCIDEFSSIKEHDRTSIHEameqqtisvakdkeskkvkvks
LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCGSPSSCDGTNFSPVTSVDQDNYKDYQEIKIQERAAGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWEDHKYDGLAARNHILASICPAIYGlylvklclavvlaggvgrggedgskvRAESHLLLVGDPGTGKSEILKFAKRMSPRsvlttgvgtttagltvsalRENGEWHLEAGALVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTIsvakdkeskkvkvks
***************EDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCG***************VDQDNYKDYQEIKIQERAAGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRG***********HLLLVGD******EILKFAKRMSPRSVLTTGVGTTTAGLTVSALRENGEWHLEAGALVLSDGGVCCIDEFSSI********************************
LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIAN********************VDQDNYKDYQEIKIQERAAGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWR*****VRSDIELCLSANYLTV**************RAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAESHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRENGEWHLEAGALVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTISVAKDKESKKVKV**
LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCGSPSSCDGTNFSPVTSVDQDNYKDYQEIKIQERAAGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAESHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRENGEWHLEAGALVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTISVA************
LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCGSPSSCDGTNFSPVTSVDQDNYKDYQEIKIQERAAGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAESHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRENGEWHLEAGALVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTISVAKDKESKKVK***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCGSPSSCDGTNFSPVTSVDQDNYKDYQEIKIQERAAGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAESHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRENGEWHLEAGALVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTISVAKDKESKKVKVKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query345 2.2.26 [Sep-21-2011]
Q2KHI9 1134 DNA helicase MCM9 OS=Mus yes N/A 0.968 0.294 0.565 1e-116
F1M5F3 1124 DNA helicase MCM9 OS=Ratt yes N/A 0.968 0.297 0.562 1e-115
F1QDI9 1133 DNA helicase MCM9 OS=Dani yes N/A 0.968 0.294 0.559 1e-115
Q9NXL9 1143 DNA helicase MCM9 OS=Homo yes N/A 0.968 0.292 0.559 1e-115
F1N2W9 1139 DNA helicase MCM9 OS=Bos yes N/A 0.968 0.293 0.554 1e-115
I0IUP4 1169 DNA helicase MCM9 OS=Gall yes N/A 0.968 0.285 0.562 1e-113
F6RIX4 1117 DNA helicase MCM9 OS=Xeno yes N/A 0.968 0.299 0.545 1e-111
Q6NRM6 1143 DNA helicase MCM9 OS=Xeno N/A N/A 0.968 0.292 0.543 1e-111
Q9UXG1 686 Minichromosome maintenanc yes N/A 0.884 0.444 0.384 1e-54
P49735 887 DNA replication licensing yes N/A 0.872 0.339 0.358 3e-43
>sp|Q2KHI9|MCM9_MOUSE DNA helicase MCM9 OS=Mus musculus GN=Mcm9 PE=1 SV=2 Back     alignment and function desciption
 Score =  419 bits (1078), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 191/338 (56%), Positives = 260/338 (76%), Gaps = 4/338 (1%)

Query: 1   LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQ 60
           LP+CP+L R   P  +D+G  L ++GTV+R ++ K+LEF R+Y+C KCK  F V+ADFEQ
Sbjct: 103 LPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFMVEADFEQ 162

Query: 61  FYSIANPLSCGSPSSCDGTNFSPVTSVDQDNYK--DYQEIKIQERAA--GVGSVPKSIWV 116
           +Y+ + P SC S +SCD + FS ++ +     +  DYQEIKIQE+     VGS+P+S+ V
Sbjct: 163 YYTFSRPSSCPSLASCDSSKFSCLSDLSSSPARCRDYQEIKIQEQVQRLSVGSIPRSMKV 222

Query: 117 TLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITP 176
            LEDDLVD  + GDD+ + G V++RW+P  + VR ++E+ L ANY+ V N+QSS +V+  
Sbjct: 223 ILEDDLVDSCKSGDDLTIYGVVMQRWKPFQRDVRCEVEIVLKANYVQVNNEQSSGMVMDE 282

Query: 177 ELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKV 236
           + R E   FWE +K D  A RN ILAS+CP ++G+YLVKL +A+VLAGG+ R    G++V
Sbjct: 283 DTRKEFEDFWEHYKSDPFAGRNEILASLCPQVFGMYLVKLAVAMVLAGGIQRTDAAGTRV 342

Query: 237 RAESHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRENGEWHLEAGA 296
           R ESHLLLVGDPGTGKS+ LK+A +++PRSVLTTG+G+T+AGLTV+A++++GEW+LEAGA
Sbjct: 343 RGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGA 402

Query: 297 LVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTISVAK 334
           LVL+D G+CCIDEF+S+KEHDRTSIHEAMEQQTISVAK
Sbjct: 403 LVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTISVAK 440





Mus musculus (taxid: 10090)
>sp|F1M5F3|MCM9_RAT DNA helicase MCM9 OS=Rattus norvegicus GN=Mcm9 PE=3 SV=2 Back     alignment and function description
>sp|F1QDI9|MCM9_DANRE DNA helicase MCM9 OS=Danio rerio GN=mcm9 PE=2 SV=2 Back     alignment and function description
>sp|Q9NXL9|MCM9_HUMAN DNA helicase MCM9 OS=Homo sapiens GN=MCM9 PE=1 SV=4 Back     alignment and function description
>sp|F1N2W9|MCM9_BOVIN DNA helicase MCM9 OS=Bos taurus GN=MCM9 PE=3 SV=2 Back     alignment and function description
>sp|I0IUP4|MCM9_CHICK DNA helicase MCM9 OS=Gallus gallus GN=MCM9 PE=1 SV=2 Back     alignment and function description
>sp|F6RIX4|MCM9_XENTR DNA helicase MCM9 OS=Xenopus tropicalis GN=mcm9 PE=3 SV=1 Back     alignment and function description
>sp|Q6NRM6|MCM9_XENLA DNA helicase MCM9 OS=Xenopus laevis GN=mcm9 PE=1 SV=1 Back     alignment and function description
>sp|Q9UXG1|MCM_SULSO Minichromosome maintenance protein MCM OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=MCM PE=1 SV=1 Back     alignment and function description
>sp|P49735|MCM2_DROME DNA replication licensing factor Mcm2 OS=Drosophila melanogaster GN=Mcm2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
405964085 1074 DNA replication licensing factor MCM9 [C 0.965 0.310 0.585 1e-120
328697678 633 PREDICTED: DNA replication licensing fac 0.962 0.524 0.595 1e-118
327261648 1149 PREDICTED: DNA replication licensing fac 0.968 0.290 0.576 1e-116
395816371 1140 PREDICTED: DNA replication licensing fac 0.968 0.292 0.571 1e-115
158564298 1134 RecName: Full=DNA helicase MCM9; AltName 0.968 0.294 0.565 1e-115
297291859 1148 PREDICTED: DNA replication licensing fac 0.968 0.290 0.573 1e-115
301766248 1141 PREDICTED: DNA replication licensing fac 0.968 0.292 0.565 1e-115
355562104 1142 hypothetical protein EGK_15399 [Macaca m 0.968 0.292 0.573 1e-114
355748944 1142 hypothetical protein EGM_14065 [Macaca f 0.968 0.292 0.571 1e-114
86439953 1290 DNA helicase MCM9 [Mus musculus] gi|8619 0.968 0.258 0.565 1e-114
>gi|405964085|gb|EKC29607.1| DNA replication licensing factor MCM9 [Crassostrea gigas] Back     alignment and taxonomy information
 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 198/338 (58%), Positives = 265/338 (78%), Gaps = 5/338 (1%)

Query: 1   LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQ 60
           LP+CP+LHRT  P   D+GS L I+GTV+R TV KMLE  R+++CTKC+    V+AD EQ
Sbjct: 108 LPVCPELHRTSVPRAGDVGSFLAITGTVIRTTVMKMLEHERDFLCTKCRNVCSVQADLEQ 167

Query: 61  FYSIANPLSCGSPSSCDGTNFSPV--TSVDQDNYKDYQEIKIQERAA--GVGSVPKSIWV 116
           F+++A P  C S  +C+ TNF+P+  T       ++YQEIKIQE+     VG++P+S+WV
Sbjct: 168 FFNLAKPSKC-SNETCNSTNFTPLCDTGGQPQKCRNYQEIKIQEQVQRLAVGTIPRSMWV 226

Query: 117 TLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITP 176
            + DDLVD  + GDDVI+CG V RRWRP     R DIE+ L AN++ V N+Q +S+++T 
Sbjct: 227 VVLDDLVDKCKAGDDVIICGTVRRRWRPSAVDSRCDIEMVLEANHILVTNEQRNSVLVTQ 286

Query: 177 ELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKV 236
           EL++E+ +FWED++ D L+ARN ILAS+CP +YGLY+VKL +A+VLAGGV R  E G++V
Sbjct: 287 ELKSEIMKFWEDNRNDPLSARNRILASLCPQVYGLYVVKLAVALVLAGGVQRVDESGTRV 346

Query: 237 RAESHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRENGEWHLEAGA 296
           R E H+L+VGDPGTGKS+ LK+A +++PRSVLTTG+G+T+AGLTV+A+++ GEW LEAGA
Sbjct: 347 RGEIHMLMVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDGGEWQLEAGA 406

Query: 297 LVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTISVAK 334
           LVL+DGG+CCIDEFSSI+EHD+ SIHEAMEQQTISVAK
Sbjct: 407 LVLADGGLCCIDEFSSIREHDKASIHEAMEQQTISVAK 444




Source: Crassostrea gigas

Species: Crassostrea gigas

Genus: Crassostrea

Family: Ostreidae

Order: Ostreoida

Class: Bivalvia

Phylum: Mollusca

Superkingdom: Eukaryota

>gi|328697678|ref|XP_001948467.2| PREDICTED: DNA replication licensing factor MCM9-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|327261648|ref|XP_003215641.1| PREDICTED: DNA replication licensing factor MCM9-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|395816371|ref|XP_003781677.1| PREDICTED: DNA replication licensing factor MCM9 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|158564298|sp|Q2KHI9.2|MCM9_MOUSE RecName: Full=DNA helicase MCM9; AltName: Full=Mini-chromosome maintenance deficient domain-containing protein 1; AltName: Full=Minichromosome maintenance 9 Back     alignment and taxonomy information
>gi|297291859|ref|XP_001110306.2| PREDICTED: DNA replication licensing factor MCM9-like isoform 1 [Macaca mulatta] Back     alignment and taxonomy information
>gi|301766248|ref|XP_002918546.1| PREDICTED: DNA replication licensing factor MCM9-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|355562104|gb|EHH18736.1| hypothetical protein EGK_15399 [Macaca mulatta] Back     alignment and taxonomy information
>gi|355748944|gb|EHH53427.1| hypothetical protein EGM_14065 [Macaca fascicularis] Back     alignment and taxonomy information
>gi|86439953|ref|NP_082106.2| DNA helicase MCM9 [Mus musculus] gi|86198294|tpe|CAJ70649.1| TPA: mini-chromosome maintenance deficient 9 [Mus musculus] gi|225000570|gb|AAI72624.1| Minichromosome maintenance complex component 9 [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
MGI|MGI:1918817 1134 Mcm9 "minichromosome maintenan 0.956 0.291 0.476 8.9e-86
RGD|1305582 1124 Mcmdc1 "minichromosome mainten 0.956 0.293 0.473 3.8e-85
UNIPROTKB|J9PA91 1141 MCM9 "Uncharacterized protein" 0.956 0.289 0.470 4.9e-85
ZFIN|ZDB-GENE-041014-310 1135 mcm9 "minichromosome maintenan 0.956 0.290 0.470 4.9e-85
UNIPROTKB|Q9NXL9 1143 MCM9 "DNA helicase MCM9" [Homo 0.956 0.288 0.470 6.2e-85
UNIPROTKB|F1SF38 1126 MCM9 "Uncharacterized protein" 0.956 0.293 0.476 6.2e-85
RGD|1560557 1250 RGD1560557 "similar to minichr 0.956 0.264 0.473 1.1e-84
UNIPROTKB|I0IUP4 1169 MCM9 "DNA helicase MCM9" [Gall 0.956 0.282 0.479 2.7e-84
UNIPROTKB|F1N2W9 1139 MCM9 "DNA helicase MCM9" [Bos 0.956 0.289 0.465 3.4e-84
UNIPROTKB|F6RIX4 1117 mcm9 "DNA helicase MCM9" [Xeno 0.956 0.295 0.462 3.6e-82
MGI|MGI:1918817 Mcm9 "minichromosome maintenance complex component 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 858 (307.1 bits), Expect = 8.9e-86, P = 8.9e-86
 Identities = 159/334 (47%), Positives = 217/334 (64%)

Query:     1 LPICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQ 60
             LP+CP+L R   P  +D+G  L ++GTV+R ++ K+LEF R+Y+C KCK  F V+ADFEQ
Sbjct:   103 LPVCPELVREHIPKTKDVGHFLSVTGTVIRTSLVKVLEFERDYMCNKCKHVFMVEADFEQ 162

Query:    61 FYSIANPLSCGSPSSCDGTNFSPVTSVDQD--NYKDYQEIKIQERAA--GVGSVPKSIWV 116
             +Y+ + P SC S +SCD + FS ++ +       +DYQEIKIQE+     VGS+P+S+ V
Sbjct:   163 YYTFSRPSSCPSLASCDSSKFSCLSDLSSSPARCRDYQEIKIQEQVQRLSVGSIPRSMKV 222

Query:   117 TLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITP 176
              LEDDLVD  + GDD+ + G V++RW+P  + VR ++E+ L ANY+ V N+QSS +V+  
Sbjct:   223 ILEDDLVDSCKSGDDLTIYGVVMQRWKPFQRDVRCEVEIVLKANYVQVNNEQSSGMVMDE 282

Query:   177 ELRAEVTQFWEDHKYDGLAARNHILASICPAIYGXXXXXXXXXXXXXXXXXXXXXXXXXX 236
             + R E   FWE +K D  A RN ILAS+CP ++G                          
Sbjct:   283 DTRKEFEDFWEHYKSDPFAGRNEILASLCPQVFGMYLVKLAVAMVLAGGIQRTDAAGTRV 342

Query:   237 RAESHLLLVGDPGTGKSEILKFAKRMSPRXXXXXXXXXXXXXXXXXXXRENGEWHLEAGA 296
             R ESHLLLVGDPGTGKS+ LK+A +++PR                   +++GEW+LEAGA
Sbjct:   343 RGESHLLLVGDPGTGKSQFLKYAAKITPRSVLTTGIGSTSAGLTVTAVKDSGEWNLEAGA 402

Query:   297 LVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTI 330
             LVL+D G+CCIDEF+S+KEHDRTSIHEAMEQQTI
Sbjct:   403 LVLADAGLCCIDEFNSLKEHDRTSIHEAMEQQTI 436




GO:0000166 "nucleotide binding" evidence=IEA
GO:0000724 "double-strand break repair via homologous recombination" evidence=ISO;IMP
GO:0003677 "DNA binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0006260 "DNA replication" evidence=IMP
GO:0006281 "DNA repair" evidence=IEA
GO:0006974 "response to DNA damage stimulus" evidence=ISO;IMP
GO:0007276 "gamete generation" evidence=IMP
GO:0007292 "female gamete generation" evidence=IMP
GO:0016787 "hydrolase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0097362 "MCM8-MCM9 complex" evidence=ISO;IDA
RGD|1305582 Mcmdc1 "minichromosome maintenance deficient domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9PA91 MCM9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041014-310 mcm9 "minichromosome maintenance complex component 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NXL9 MCM9 "DNA helicase MCM9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SF38 MCM9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1560557 RGD1560557 "similar to minichromosome maintenance protein 8 isoform 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I0IUP4 MCM9 "DNA helicase MCM9" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N2W9 MCM9 "DNA helicase MCM9" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6RIX4 mcm9 "DNA helicase MCM9" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
I0IUP4MCM9_CHICK3, ., 6, ., 4, ., 1, 20.56210.96810.2857yesN/A
Q9NXL9MCM9_HUMANNo assigned EC number0.55910.96810.2922yesN/A
F1N2W9MCM9_BOVIN3, ., 6, ., 4, ., 1, 20.55480.96810.2932yesN/A
F1M5F3MCM9_RAT3, ., 6, ., 4, ., 1, 20.56210.96810.2971yesN/A
Q2KHI9MCM9_MOUSENo assigned EC number0.56500.96810.2945yesN/A
F1QDI9MCM9_DANRE3, ., 6, ., 4, ., 1, 20.55910.96810.2947yesN/A
F6RIX4MCM9_XENTR3, ., 6, ., 4, ., 1, 20.54590.96810.2990yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
COG1241 682 COG1241, MCM2, Predicted ATPase involved in replic 1e-86
smart00350 509 smart00350, MCM, minichromosome maintenance protei 2e-83
pfam00493 327 pfam00493, MCM, MCM2/3/5 family 3e-69
PTZ00111 915 PTZ00111, PTZ00111, DNA replication licensing fact 2e-31
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 1e-07
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 7e-06
>gnl|CDD|224162 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
 Score =  274 bits (702), Expect = 1e-86
 Identities = 130/331 (39%), Positives = 181/331 (54%), Gaps = 25/331 (7%)

Query: 14  NNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCGSP 73
            +E IG L+ + G V R +  +    +  + C KC +   V    +  + +  P  C   
Sbjct: 101 RSEHIGKLVSVEGIVTRASEVRPRLKKAVFECPKCGREVEV---EQSEFRVEPPREC--E 155

Query: 74  SSCDGTNFSPVTSVDQDNYKDYQEIKIQERAAGV--GSVPKSIWVTLEDDLVDLARPGDD 131
           +              +  + D+Q++KIQE    V  G +P+SI V LEDDLVD  RPGD 
Sbjct: 156 NCGKFGKGPLKLVPRKSEFIDFQKVKIQELPELVPGGELPRSIEVILEDDLVDSVRPGDR 215

Query: 132 VIVCGAVLRRWRPVVKGVRSDI--ELCLSANYLTVCNDQSSSLVITPELRAEVTQFWEDH 189
           V + G V       + G R     E+ L AN      D+   + IT E   E+ +     
Sbjct: 216 VKITGVVRIVPSRSLSGRRKGPVFEIYLEANS-VEKLDKREEVEITEEDEEEIKE----- 269

Query: 190 KYDGLAARNHIL----ASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAESHLLLV 245
               LA R  I      SI P+IYG   VK  + + L GGV +   DG+++R + H+LLV
Sbjct: 270 ----LAKRPDIYDILIKSIAPSIYGHEDVKKAILLQLFGGVKKNLPDGTRIRGDIHILLV 325

Query: 246 GDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRE--NGEWHLEAGALVLSDGG 303
           GDPGT KS++LK+  +++PR V T+G G++ AGLT + +R+   GEW LEAGALVL+DGG
Sbjct: 326 GDPGTAKSQLLKYVAKLAPRGVYTSGKGSSAAGLTAAVVRDKVTGEWVLEAGALVLADGG 385

Query: 304 VCCIDEFSSIKEHDRTSIHEAMEQQTISVAK 334
           VCCIDEF  + E DR +IHEAMEQQTIS+AK
Sbjct: 386 VCCIDEFDKMNEEDRVAIHEAMEQQTISIAK 416


Length = 682

>gnl|CDD|214631 smart00350, MCM, minichromosome maintenance proteins Back     alignment and domain information
>gnl|CDD|215947 pfam00493, MCM, MCM2/3/5 family Back     alignment and domain information
>gnl|CDD|173403 PTZ00111, PTZ00111, DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 345
KOG0480|consensus 764 100.0
COG1241 682 MCM2 Predicted ATPase involved in replication cont 100.0
KOG0482|consensus 721 100.0
KOG0478|consensus 804 100.0
KOG0477|consensus 854 100.0
KOG0481|consensus 729 100.0
KOG0479|consensus 818 100.0
smart00350 509 MCM minichromosome maintenance proteins. 100.0
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 100.0
PF00493 331 MCM: MCM2/3/5 family This family extends the MCM d 100.0
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.83
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 99.69
COG0606 490 Predicted ATPase with chaperone activity [Posttran 99.69
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.64
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 99.62
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.61
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 99.6
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.56
PRK09862 506 putative ATP-dependent protease; Provisional 99.54
PRK13531 498 regulatory ATPase RavA; Provisional 99.52
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.5
PF07726131 AAA_3: ATPase family associated with various cellu 99.44
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.43
COG0714 329 MoxR-like ATPases [General function prediction onl 99.42
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 99.39
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 99.34
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 99.33
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.33
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.31
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.3
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 99.25
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 99.25
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.2
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 99.18
CHL00181 287 cbbX CbbX; Provisional 99.14
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.13
COG3604 550 FhlA Transcriptional regulator containing GAF, AAA 99.11
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.09
KOG2004|consensus 906 99.08
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.07
COG2204 464 AtoC Response regulator containing CheY-like recei 99.06
PHA02244 383 ATPase-like protein 99.03
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.02
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.01
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.0
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.99
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 98.99
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.97
PRK13765 637 ATP-dependent protease Lon; Provisional 98.95
PRK15424 538 propionate catabolism operon regulatory protein Pr 98.95
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.93
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.93
COG1221 403 PspF Transcriptional regulators containing an AAA- 98.92
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 98.92
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 98.89
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 98.87
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.86
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 98.85
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.85
PRK11608 326 pspF phage shock protein operon transcriptional ac 98.84
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 98.82
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 98.8
KOG0989|consensus 346 98.8
CHL00095 821 clpC Clp protease ATP binding subunit 98.77
PLN03025 319 replication factor C subunit; Provisional 98.77
PRK13342 413 recombination factor protein RarA; Reviewed 98.77
KOG0745|consensus 564 98.76
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.74
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.74
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 98.73
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.71
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.7
PRK05022 509 anaerobic nitric oxide reductase transcription reg 98.69
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.69
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 98.68
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.67
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 98.66
PRK10865 857 protein disaggregation chaperone; Provisional 98.63
COG3283 511 TyrR Transcriptional regulator of aromatic amino a 98.61
KOG2028|consensus 554 98.6
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 98.57
PRK13341 725 recombination factor protein RarA/unknown domain f 98.55
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 98.55
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.55
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 98.51
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.51
PF00004132 AAA: ATPase family associated with various cellula 98.49
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.49
KOG0991|consensus 333 98.49
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 98.49
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.48
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 98.46
COG3284 606 AcoR Transcriptional activator of acetoin/glycerol 98.45
KOG0739|consensus 439 98.45
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.45
KOG1051|consensus 898 98.44
PRK15115 444 response regulator GlrR; Provisional 98.41
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 98.41
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.4
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.4
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.39
PRK12402 337 replication factor C small subunit 2; Reviewed 98.38
KOG0737|consensus 386 98.38
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.38
PRK07940 394 DNA polymerase III subunit delta'; Validated 98.37
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.36
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.36
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 98.35
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.35
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.34
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.33
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.33
KOG0733|consensus 802 98.32
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.31
PRK03992 389 proteasome-activating nucleotidase; Provisional 98.3
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.29
PRK10365 441 transcriptional regulatory protein ZraR; Provision 98.29
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.29
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 98.29
KOG0734|consensus 752 98.29
KOG0738|consensus 491 98.28
PRK00440 319 rfc replication factor C small subunit; Reviewed 98.27
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.27
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.27
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.27
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.26
CHL00195 489 ycf46 Ycf46; Provisional 98.25
PHA02544 316 44 clamp loader, small subunit; Provisional 98.25
KOG0736|consensus 953 98.24
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.24
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.21
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.2
COG4650 531 RtcR Sigma54-dependent transcription regulator con 98.2
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 98.19
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.18
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.17
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.17
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.16
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.14
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 98.14
PRK04195 482 replication factor C large subunit; Provisional 98.11
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.09
CHL00176 638 ftsH cell division protein; Validated 98.08
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.08
PRK09112 351 DNA polymerase III subunit delta'; Validated 98.07
smart00382148 AAA ATPases associated with a variety of cellular 98.06
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 98.06
KOG0727|consensus 408 98.06
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.05
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.03
PRK05564 313 DNA polymerase III subunit delta'; Validated 98.03
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.01
KOG0652|consensus 424 98.0
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 97.99
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.98
PRK07471 365 DNA polymerase III subunit delta'; Validated 97.96
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.96
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 97.95
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.94
KOG0742|consensus 630 97.92
KOG0735|consensus 952 97.91
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 97.91
TIGR02688 449 conserved hypothetical protein TIGR02688. Members 97.89
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 97.87
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.86
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 97.84
KOG0733|consensus 802 97.83
PF13337 457 Lon_2: Putative ATP-dependent Lon protease 97.83
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 97.83
PRK07399 314 DNA polymerase III subunit delta'; Validated 97.83
KOG0728|consensus 404 97.82
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 97.81
PRK10865 857 protein disaggregation chaperone; Provisional 97.81
CHL00095 821 clpC Clp protease ATP binding subunit 97.8
KOG0731|consensus 774 97.79
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 97.78
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.77
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.77
KOG0744|consensus 423 97.74
PRK08058 329 DNA polymerase III subunit delta'; Validated 97.73
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.73
KOG0730|consensus 693 97.72
KOG0743|consensus 457 97.7
PRK06893229 DNA replication initiation factor; Validated 97.67
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.66
PHA01747 425 putative ATP-dependent protease 97.65
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.6
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.52
KOG0726|consensus 440 97.51
KOG0740|consensus 428 97.51
KOG0729|consensus 435 97.48
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.47
PF12774 231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.46
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 97.46
PRK12377248 putative replication protein; Provisional 97.45
PRK06620214 hypothetical protein; Validated 97.41
CHL00206 2281 ycf2 Ycf2; Provisional 97.39
PRK08084235 DNA replication initiation factor; Provisional 97.34
PRK06526254 transposase; Provisional 97.33
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 97.32
PRK00411 394 cdc6 cell division control protein 6; Reviewed 97.32
PRK08116268 hypothetical protein; Validated 97.31
KOG0651|consensus 388 97.3
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 97.29
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.29
TIGR02653 675 Lon_rel_chp conserved hypothetical protein. This m 97.26
PRK15455 644 PrkA family serine protein kinase; Provisional 97.22
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 97.19
KOG2170|consensus 344 97.19
KOG0990|consensus 360 97.17
PRK05707 328 DNA polymerase III subunit delta'; Validated 97.16
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.16
PRK08181269 transposase; Validated 97.16
PTZ00112 1164 origin recognition complex 1 protein; Provisional 97.12
PRK09183259 transposase/IS protein; Provisional 97.07
KOG1969|consensus 877 97.05
PRK08727233 hypothetical protein; Validated 96.99
PRK04296190 thymidine kinase; Provisional 96.96
PRK09087226 hypothetical protein; Validated 96.93
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 96.81
PRK08769 319 DNA polymerase III subunit delta'; Validated 96.78
PRK06871 325 DNA polymerase III subunit delta'; Validated 96.77
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 96.75
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.74
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 96.73
KOG3347|consensus176 96.72
PRK07952244 DNA replication protein DnaC; Validated 96.72
PRK07993 334 DNA polymerase III subunit delta'; Validated 96.64
PRK05642234 DNA replication initiation factor; Validated 96.63
PHA02774613 E1; Provisional 96.63
PRK08699 325 DNA polymerase III subunit delta'; Validated 96.61
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.58
PF13173128 AAA_14: AAA domain 96.57
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.56
PRK12422 445 chromosomal replication initiation protein; Provis 96.51
PRK14532188 adenylate kinase; Provisional 96.49
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 96.46
PRK13947171 shikimate kinase; Provisional 96.43
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.41
PRK06090 319 DNA polymerase III subunit delta'; Validated 96.4
PF01443 234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 96.4
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.38
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 96.33
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.31
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 96.31
PRK08118167 topology modulation protein; Reviewed 96.25
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 96.24
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.24
PRK03839180 putative kinase; Provisional 96.24
PF1324576 AAA_19: Part of AAA domain 96.23
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 96.23
COG1067 647 LonB Predicted ATP-dependent protease [Posttransla 96.22
KOG0730|consensus 693 96.19
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.17
PRK00131175 aroK shikimate kinase; Reviewed 96.16
PHA00729 226 NTP-binding motif containing protein 96.14
PRK14530 215 adenylate kinase; Provisional 96.12
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.11
KOG1808|consensus 1856 96.1
PRK00625173 shikimate kinase; Provisional 96.08
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.06
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.06
PRK05917 290 DNA polymerase III subunit delta'; Validated 96.05
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.02
PRK14086 617 dnaA chromosomal replication initiation protein; P 96.01
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 95.99
PHA02624 647 large T antigen; Provisional 95.99
PRK07261171 topology modulation protein; Provisional 95.98
PRK13949169 shikimate kinase; Provisional 95.97
COG4178604 ABC-type uncharacterized transport system, permeas 95.96
PTZ00088 229 adenylate kinase 1; Provisional 95.94
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 95.92
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.9
PRK14087 450 dnaA chromosomal replication initiation protein; P 95.9
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 95.9
PRK06964 342 DNA polymerase III subunit delta'; Validated 95.83
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.82
KOG0741|consensus 744 95.81
PRK04132 846 replication factor C small subunit; Provisional 95.76
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 95.75
PRK14531183 adenylate kinase; Provisional 95.75
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.74
PRK06217183 hypothetical protein; Validated 95.73
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.72
PRK05057172 aroK shikimate kinase I; Reviewed 95.66
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 95.65
PF06048286 DUF927: Domain of unknown function (DUF927); Inter 95.65
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.62
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 95.62
PRK06762166 hypothetical protein; Provisional 95.6
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.59
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 95.58
PRK14526 211 adenylate kinase; Provisional 95.57
PRK14528186 adenylate kinase; Provisional 95.57
PRK10875 615 recD exonuclease V subunit alpha; Provisional 95.55
PRK13764 602 ATPase; Provisional 95.55
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 95.52
KOG2035|consensus 351 95.52
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 95.5
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 95.48
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.44
TIGR01351 210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 95.44
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 95.43
PRK06921266 hypothetical protein; Provisional 95.41
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.4
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.4
PRK02496184 adk adenylate kinase; Provisional 95.4
PRK06835329 DNA replication protein DnaC; Validated 95.35
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.34
cd01878204 HflX HflX subfamily. A distinct conserved domain w 95.34
PF05729166 NACHT: NACHT domain 95.28
COG4619223 ABC-type uncharacterized transport system, ATPase 95.28
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 95.27
PF13479 213 AAA_24: AAA domain 95.25
PRK00279 215 adk adenylate kinase; Reviewed 95.24
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 95.22
TIGR01618 220 phage_P_loop phage nucleotide-binding protein. Thi 95.22
PLN02200234 adenylate kinase family protein 95.21
PHA02530 300 pseT polynucleotide kinase; Provisional 95.21
KOG0732|consensus 1080 95.21
PRK03731171 aroL shikimate kinase II; Reviewed 95.2
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 95.17
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.16
PRK13946184 shikimate kinase; Provisional 95.14
COG0703172 AroK Shikimate kinase [Amino acid transport and me 95.14
PRK08233182 hypothetical protein; Provisional 95.12
PF1355562 AAA_29: P-loop containing region of AAA domain 95.11
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 95.08
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 95.04
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 95.01
PRK13948182 shikimate kinase; Provisional 95.01
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 94.97
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 94.92
PRK08939306 primosomal protein DnaI; Reviewed 94.89
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 94.85
PLN02459 261 probable adenylate kinase 94.84
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 94.83
PRK14529 223 adenylate kinase; Provisional 94.81
PRK13826 1102 Dtr system oriT relaxase; Provisional 94.75
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 94.74
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 94.74
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 94.74
PLN02674 244 adenylate kinase 94.73
PRK13851344 type IV secretion system protein VirB11; Provision 94.7
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.7
PRK14527191 adenylate kinase; Provisional 94.69
PRK00300205 gmk guanylate kinase; Provisional 94.6
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 94.57
PF03969 362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 94.57
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 94.55
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 94.54
PRK04040188 adenylate kinase; Provisional 94.49
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 94.48
PRK03846198 adenylylsulfate kinase; Provisional 94.45
COG1936180 Predicted nucleotide kinase (related to CMP and AM 94.43
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 94.41
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 94.4
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 94.3
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 94.3
PRK00149 450 dnaA chromosomal replication initiation protein; R 94.28
PRK12339197 2-phosphoglycerate kinase; Provisional 94.28
PRK04182180 cytidylate kinase; Provisional 94.26
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.2
PRK13889 988 conjugal transfer relaxase TraA; Provisional 94.2
PRK01184184 hypothetical protein; Provisional 94.2
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 94.18
PRK14088 440 dnaA chromosomal replication initiation protein; P 94.17
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 94.14
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.13
TIGR00231161 small_GTP small GTP-binding protein domain. This m 94.1
TIGR02237209 recomb_radB DNA repair and recombination protein R 94.1
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 94.09
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.07
TIGR00235207 udk uridine kinase. Model contains a number of lon 94.07
cd03112158 CobW_like The function of this protein family is u 94.06
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 94.05
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 94.05
KOG0060|consensus659 94.01
PLN02165 334 adenylate isopentenyltransferase 93.94
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.92
KOG1942|consensus 456 93.91
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 93.88
PF13654 509 AAA_32: AAA domain; PDB: 3K1J_B. 93.87
COG4525 259 TauB ABC-type taurine transport system, ATPase com 93.87
PRK06547172 hypothetical protein; Provisional 93.87
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 93.86
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 93.85
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 93.85
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 93.84
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 93.81
PRK05480209 uridine/cytidine kinase; Provisional 93.8
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 93.8
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 93.8
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 93.79
COG4088 261 Predicted nucleotide kinase [Nucleotide transport 93.78
PRK05541176 adenylylsulfate kinase; Provisional 93.76
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 93.75
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 93.74
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 93.74
PRK07132 299 DNA polymerase III subunit delta'; Validated 93.73
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 93.69
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 93.68
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 93.67
PRK13808 333 adenylate kinase; Provisional 93.65
PRK09825176 idnK D-gluconate kinase; Provisional 93.65
PRK08154309 anaerobic benzoate catabolism transcriptional regu 93.65
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 93.65
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 93.63
cd00154159 Rab Rab family. Rab GTPases form the largest famil 93.61
cd03239178 ABC_SMC_head The structural maintenance of chromos 93.59
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 93.56
COG1136226 SalX ABC-type antimicrobial peptide transport syst 93.55
KOG0736|consensus 953 93.55
PF00519432 PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 93.55
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 93.54
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 93.51
PRK10536262 hypothetical protein; Provisional 93.5
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 93.48
PRK00889175 adenylylsulfate kinase; Provisional 93.47
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 93.46
PRK14737186 gmk guanylate kinase; Provisional 93.43
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 93.42
PRK00093 435 GTP-binding protein Der; Reviewed 93.41
TIGR00017 217 cmk cytidylate kinase. This family consists of cyt 93.41
PF00735 281 Septin: Septin; InterPro: IPR000038 Septins consti 93.39
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 93.39
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 93.36
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 93.36
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 93.34
PRK13695174 putative NTPase; Provisional 93.33
PRK10416318 signal recognition particle-docking protein FtsY; 93.32
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 93.32
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 93.32
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 93.31
cd00876160 Ras Ras family. The Ras family of the Ras superfam 93.31
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 93.3
PRK13833323 conjugal transfer protein TrbB; Provisional 93.3
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 93.27
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 93.27
cd03269210 ABC_putative_ATPase This subfamily is involved in 93.24
cd01394218 radB RadB. The archaeal protein radB shares simila 93.23
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 93.22
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 93.22
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 93.22
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 93.2
PRK14738206 gmk guanylate kinase; Provisional 93.18
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 93.17
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 93.16
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 93.14
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.13
PRK09361225 radB DNA repair and recombination protein RadB; Pr 93.12
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 93.11
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.1
cd01896 233 DRG The developmentally regulated GTP-binding prot 93.09
TIGR02236 310 recomb_radA DNA repair and recombination protein R 93.09
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 93.08
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 93.06
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 93.05
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 93.02
PRK08356195 hypothetical protein; Provisional 93.01
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 93.0
PRK13894319 conjugal transfer ATPase TrbB; Provisional 92.98
KOG0741|consensus 744 92.97
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 92.97
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 92.97
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 92.95
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 92.94
PLN02199303 shikimate kinase 92.94
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 92.94
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 92.91
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 92.91
cd03216163 ABC_Carb_Monos_I This family represents the domain 92.91
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 92.91
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 92.9
PRK13975196 thymidylate kinase; Provisional 92.89
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 92.89
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 92.87
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 92.87
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 92.87
TIGR00376 637 DNA helicase, putative. The gene product may repre 92.86
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 92.85
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 92.85
cd03246173 ABCC_Protease_Secretion This family represents the 92.84
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 92.84
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 92.83
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 92.82
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 92.81
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 92.8
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 92.8
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 92.79
TIGR03881 229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 92.77
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 92.75
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 92.71
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 92.7
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 92.68
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 92.67
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 92.66
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 92.66
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 92.63
PRK10646153 ADP-binding protein; Provisional 92.59
>KOG0480|consensus Back     alignment and domain information
Probab=100.00  E-value=1.9e-82  Score=613.76  Aligned_cols=332  Identities=35%  Similarity=0.566  Sum_probs=283.7

Q ss_pred             CCcccccccCCCCCCCCcEEEEEEEEEEecCCceEEEEEEEEeCCCCcEEEEeecccccccccCCcCCCCCCCCCCCC-e
Q psy1366           3 ICPQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCGSPSSCDGTN-F   81 (345)
Q Consensus         3 ~~~~~~~~~~~~s~~igkLV~i~G~Vir~s~vk~~~~~~~f~C~~C~~~~~~~~~~~~~~~~~~p~~C~~~~~C~~~~-f   81 (345)
                      +-|..++.+.+++..+|+||+|.|+|+|+|+|+|.+++++|.|..||..+..   .++.++|++|..||| ..|.++. |
T Consensus       118 nlp~~~~irdlra~~iG~Lv~isGtVvRts~VrPelt~~~F~C~~C~t~i~~---v~q~fkYt~Pt~C~n-p~C~nrr~f  193 (764)
T KOG0480|consen  118 NLPTRHKIRDLRAARIGKLVRISGTVVRTSPVRPELTKMTFLCEKCGTVIRN---VEQQFKYTEPTKCPN-PVCSNRRSF  193 (764)
T ss_pred             ccccccccccccHhhhcceEEEEEEEEEeecccceeeeeEEEHhhCCCeecc---chhcCccCCCccCCC-ccccCCcee
Confidence            3477799999999999999999999999999999999999999999998764   345679999999999 4898854 6


Q ss_pred             eeeecCCCCceeeeeeEEEeeec--CCCCCCceEEEEEEecCccccccCCCEEEEEEEEeeeee--ec-ccCc-------
Q psy1366          82 SPVTSVDQDNYKDYQEIKIQERA--AGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWR--PV-VKGV-------  149 (345)
Q Consensus        82 ~~l~~~~~~~~~d~Q~IriQE~~--~~~g~~prsi~V~l~~dlv~~~~pGd~V~i~Gil~~~~~--~~-~~~~-------  149 (345)
                      .+.  ..++.|.|||+|||||..  .|.|.+||+++|+|++|+|++|+|||+|.+||++.....  .+ ..+.       
T Consensus       194 ~l~--~~~s~f~D~QkIrIQE~~~E~p~GsiPRtvdviLr~dlVe~~~pGD~v~~TGiliVvpdv~~l~~pgsk~~n~r~  271 (764)
T KOG0480|consen  194 TLD--RSSSRFLDWQKIRIQELQAEIPRGSIPRTVDVILRGDLVETAQPGDKVDITGILIVVPDVSQLGGPGSKAENNRG  271 (764)
T ss_pred             eee--cccceeeeeeeeehhhhhhhCCCCCCCceeEEEEhhhhHhhcCCCCEEEEEEEEEEecChHHhcCCccccccccC
Confidence            665  677899999999999998  899999999999999999999999999999999976421  00 0111       


Q ss_pred             -c-ceeEEEeeeceeeeeccCC--------CC------------cccCHHHHHHHHHHHHhhccChhhHHHHHHhccCcc
Q psy1366         150 -R-SDIELCLSANYLTVCNDQS--------SS------------LVITPELRAEVTQFWEDHKYDGLAARNHILASICPA  207 (345)
Q Consensus       150 -~-~~~~~~i~a~~i~~~~~~~--------~~------------~~~~~e~~~~~~~~~~~~~~~~~~~~~~l~~s~~p~  207 (345)
                       . ...-+.++|++|...+.+.        ..            ..++.+   +|.++.+......  .|.+|+.|++|.
T Consensus       272 ~~~~~~i~~lkal~Vrdl~yq~aFlac~~~~~~~~ee~~~~~~~~~~s~~---e~~~~~em~~~~n--ly~~lv~Sl~Ps  346 (764)
T KOG0480|consen  272 GETGDGITGLKALGVRDLTYQLAFLACHVQSTLAVEEDDEEDMLNSMSSE---EFAEIREMSKDEN--LYKNLVNSLFPS  346 (764)
T ss_pred             CCcccceeeehhcccccchhhhhHhhhhcccccccchhhhHHHhhhccHH---HHHHHHHHhcCch--HHHHHHHhhCcc
Confidence             1 1344677888776544330        00            012222   3333333322222  258899999999


Q ss_pred             cccchHHHHHHHHHHhCCCcccCCCCCceeeeeceeeeCCCCChHHHHHHHHHhhCCCeEEEcCCccCcCCceEEEEeec
Q psy1366         208 IYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAESHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALREN  287 (345)
Q Consensus       208 i~G~~~vk~~i~l~l~~g~~~~~~~~~~~r~~~~iLl~G~pGtGKs~l~~~i~~~~~~~~~~~~~~~~~~glt~~~~~~~  287 (345)
                      ||||+.||++|+|+|+||+.|...+|+.+||++||+++|||||||||+|++++..+||++|++|+.++++|||++++||.
T Consensus       347 IyGhe~VK~GilL~LfGGv~K~a~eg~~lRGDinv~iVGDPgt~KSQfLk~v~~fsPR~vYtsGkaSSaAGLTaaVvkD~  426 (764)
T KOG0480|consen  347 IYGHELVKAGILLSLFGGVHKSAGEGTSLRGDINVCIVGDPGTGKSQFLKAVCAFSPRSVYTSGKASSAAGLTAAVVKDE  426 (764)
T ss_pred             ccchHHHHhhHHHHHhCCccccCCCCccccCCceEEEeCCCCccHHHHHHHHhccCCcceEecCcccccccceEEEEecC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999984


Q ss_pred             --CeeEeeeceeeecCCcEEEEcCCCCCCHHhHHHHHHHHhCCEEEEeeCCeEEEeccCC
Q psy1366         288 --GEWHLEAGALVLSDGGVCCIDEFSSIKEHDRTSIHEAMEQQTISVAKDKESKKVKVKS  345 (345)
Q Consensus       288 --~~~~~~~G~l~la~~gi~~IDEidk~~~~~~~~l~eame~~~i~i~k~gi~~~l~ar~  345 (345)
                        |+|.++||||++||+|||||||||||+..+|.+||||||||+|||+|||+.+|||||+
T Consensus       427 esgdf~iEAGALmLADnGICCIDEFDKMd~~dqvAihEAMEQQtISIaKAGv~aTLnARt  486 (764)
T KOG0480|consen  427 ESGDFTIEAGALMLADNGICCIDEFDKMDVKDQVAIHEAMEQQTISIAKAGVVATLNART  486 (764)
T ss_pred             CCCceeeecCcEEEccCceEEechhcccChHhHHHHHHHHHhheehheecceEEeecchh
Confidence              9999999999999999999999999999999999999999999999999999999996



>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0482|consensus Back     alignment and domain information
>KOG0478|consensus Back     alignment and domain information
>KOG0477|consensus Back     alignment and domain information
>KOG0481|consensus Back     alignment and domain information
>KOG0479|consensus Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PF13337 Lon_2: Putative ATP-dependent Lon protease Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02653 Lon_rel_chp conserved hypothetical protein Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG2170|consensus Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>KOG1808|consensus Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF06048 DUF927: Domain of unknown function (DUF927); InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1 Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>KOG2035|consensus Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PF13654 AAA_32: AAA domain; PDB: 3K1J_B Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
3f9v_A 595 Crystal Structure Of A Near Full-Length Archaeal Mc 6e-38
2vl6_A268 Structural Analysis Of The Sulfolobus Solfataricus 3e-10
1ltl_A279 The Dodecamer Structure Of Mcm From Archaeal M. The 8e-06
3f8t_A 506 Crystal Structure Analysis Of A Full-Length Mcm Hom 4e-04
>pdb|3F9V|A Chain A, Crystal Structure Of A Near Full-Length Archaeal Mcm: Functional Insights For An Aaa+ Hexameric Helicase Length = 595 Back     alignment and structure

Iteration: 1

Score = 154 bits (389), Expect = 6e-38, Method: Compositional matrix adjust. Identities = 104/324 (32%), Positives = 159/324 (49%), Gaps = 23/324 (7%) Query: 17 DIGSLLQISGTVVRITVAKMLEFRREY--VCTKCKQCFYVKADFEQFYSIANPL---SCG 71 DIG L+ I G +V++T K ++ Y + C Q F D E + P CG Sbjct: 110 DIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVLEMPTICPKCG 169 Query: 72 SPSSCDGTNFSPVTSVDQDNYKDYQEIKIQERAAGV--GSVPKSIWVTLEDDLVDLARPG 129 P P ++ D+Q+ IQER V G +P+ + + LEDDLVD ARPG Sbjct: 170 KPGQF---RLIP----EKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPG 222 Query: 130 DDVIVCGAV-LRRWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWED 188 D V V G + +++ PV +G R+ ++ + + + V ++I+ E ++ +D Sbjct: 223 DRVKVTGILDIKQDSPVKRGSRAVFDIYMKVSSIEVSQKVLDEVIISEEDEKKIKDLAKD 282 Query: 189 HKYDGLAARNHILASICPAIYGXXXXXXXXXXXXXXXXXXXXXXXXXXRAESHLLLVGDP 248 R+ I++SI P+IYG R + H+L++GDP Sbjct: 283 P-----WIRDRIISSIAPSIYGHWELKEALALALFGGVPKVLEDTRI-RGDIHILIIGDP 336 Query: 249 GTGKSEILKFAKRMSPRXXXXXXXXXXXXXXXXXXXRENG--EWHLEAGALVLSDGGVCC 306 GT KS++L+F R++PR RE G E++LEAGALVL+DGG+ Sbjct: 337 GTAKSQMLQFISRVAPRAVYTTGKGSTAAGLTAAVVREKGTGEYYLEAGALVLADGGIAV 396 Query: 307 IDEFSSIKEHDRTSIHEAMEQQTI 330 IDE +++ DR +IHEAMEQQT+ Sbjct: 397 IDEIDKMRDEDRVAIHEAMEQQTV 420
>pdb|2VL6|A Chain A, Structural Analysis Of The Sulfolobus Solfataricus Mcm Protein N-Terminal Domain Length = 268 Back     alignment and structure
>pdb|1LTL|A Chain A, The Dodecamer Structure Of Mcm From Archaeal M. Thermoautotrophicum Length = 279 Back     alignment and structure
>pdb|3F8T|A Chain A, Crystal Structure Analysis Of A Full-Length Mcm Homolog From Methanopyrus Kandleri Length = 506 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 1e-108
3f8t_A 506 Predicted ATPase involved in replication control, 1e-81
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 2e-25
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 3e-25
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Length = 595 Back     alignment and structure
 Score =  328 bits (842), Expect = e-108
 Identities = 124/329 (37%), Positives = 189/329 (57%), Gaps = 19/329 (5%)

Query: 14  NNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCK--QCFYVKADFEQFYSIANPLSCG 71
            + DIG L+ I G +V++T  K   ++  Y        Q F    D E    +  P  C 
Sbjct: 107 RSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVLEMPTIC- 165

Query: 72  SPSSCDGTNFSPVTSVDQDNYKDYQEIKIQERAAGV--GSVPKSIWVTLEDDLVDLARPG 129
            P       F  +   ++    D+Q+  IQER   V  G +P+ + + LEDDLVD ARPG
Sbjct: 166 -PKCGKPGQFRLIP--EKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPG 222

Query: 130 DDVIVCGAVLR--RWRPVVKGVRSDIELCLSANYLTVCNDQSSSLVITPELRAEVTQFWE 187
           D V V G +L   +  PV +G R+  ++ +  + + V       ++I+ E   ++    +
Sbjct: 223 DRVKVTG-ILDIKQDSPVKRGSRAVFDIYMKVSSIEVSQKVLDEVIISEEDEKKIKDLAK 281

Query: 188 DHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAESHLLLVGD 247
           D        R+ I++SI P+IYG + +K  LA+ L GGV +  ED  ++R + H+L++GD
Sbjct: 282 DPW-----IRDRIISSIAPSIYGHWELKEALALALFGGVPKVLEDT-RIRGDIHILIIGD 335

Query: 248 PGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALR--ENGEWHLEAGALVLSDGGVC 305
           PGT KS++L+F  R++PR+V TTG G+T AGLT + +R    GE++LEAGALVL+DGG+ 
Sbjct: 336 PGTAKSQMLQFISRVAPRAVYTTGKGSTAAGLTAAVVREKGTGEYYLEAGALVLADGGIA 395

Query: 306 CIDEFSSIKEHDRTSIHEAMEQQTISVAK 334
            IDE   +++ DR +IHEAMEQQT+S+AK
Sbjct: 396 VIDEIDKMRDEDRVAIHEAMEQQTVSIAK 424


>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Length = 506 Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Length = 268 Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Length = 279 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Length = 350 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 100.0
3f8t_A 506 Predicted ATPase involved in replication control, 100.0
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 100.0
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 100.0
2r44_A 331 Uncharacterized protein; putative ATPase, structur 99.55
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.54
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.47
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 99.36
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.22
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.21
3co5_A143 Putative two-component system transcriptional RES 99.19
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 99.15
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 99.15
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.08
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 99.06
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.05
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 99.05
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 99.04
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 99.0
3pvs_A 447 Replication-associated recombination protein A; ma 98.93
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.91
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 98.9
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.84
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.79
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 98.78
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.75
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 98.68
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.68
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.65
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 98.61
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.6
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.6
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 98.6
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 98.59
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 98.59
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.59
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.58
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.58
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 98.57
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.56
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.55
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.48
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.46
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 98.46
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.46
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.45
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 98.45
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 98.43
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.41
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.41
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.39
2chq_A 319 Replication factor C small subunit; DNA-binding pr 98.38
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.36
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 98.33
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.31
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 98.31
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 98.3
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 98.3
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 98.29
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 98.28
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.26
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.25
3bos_A242 Putative DNA replication factor; P-loop containing 98.2
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 98.19
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 98.16
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.15
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.14
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.14
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.12
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.1
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 98.1
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.05
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.04
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.02
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 97.97
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.94
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.9
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 97.88
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.86
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.74
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.74
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.73
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.71
1tue_A212 Replication protein E1; helicase, replication, E1E 97.68
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 97.59
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.54
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.46
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 97.34
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.31
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.28
2qgz_A308 Helicase loader, putative primosome component; str 97.16
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.15
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.02
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.93
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.84
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.74
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 96.61
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.45
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.44
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 96.37
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 96.36
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.26
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.19
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.18
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.92
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.89
1via_A175 Shikimate kinase; structural genomics, transferase 95.88
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.79
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 95.76
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.75
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.73
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.65
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.64
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.62
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.54
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.51
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 95.46
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 95.46
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.45
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.43
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.4
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.4
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.34
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 95.32
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.29
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.27
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.23
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.22
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.22
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.2
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.19
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.17
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.16
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.15
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 95.15
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 95.11
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 95.1
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.09
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 95.06
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 95.06
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 95.04
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.0
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.99
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 94.97
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.95
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.92
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 94.91
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 94.9
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 94.9
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.86
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 94.86
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 94.86
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.85
2ewv_A 372 Twitching motility protein PILT; pilus retraction 94.82
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 94.8
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.79
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.78
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.77
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.77
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.76
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 94.74
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 94.72
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.71
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.63
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.61
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 94.6
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.59
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.53
4a74_A231 DNA repair and recombination protein RADA; hydrola 94.52
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.5
2fna_A 357 Conserved hypothetical protein; structural genomic 94.44
3t1o_A198 Gliding protein MGLA; G domain containing protein, 94.43
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 94.37
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 94.31
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 94.3
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 94.29
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.28
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 94.26
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 94.23
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.22
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 94.16
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 94.16
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 94.15
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 94.12
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 94.12
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 94.11
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 94.1
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 94.1
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.09
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 94.09
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 94.08
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 94.07
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.03
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 94.0
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.99
2cvh_A220 DNA repair and recombination protein RADB; filamen 93.97
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 93.97
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 93.97
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.96
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 93.95
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 93.91
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 93.89
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 93.88
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 93.87
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 93.87
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 93.86
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.85
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 93.84
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 93.84
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 93.82
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 93.77
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 93.77
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 93.77
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 93.75
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 93.75
1nrj_B218 SR-beta, signal recognition particle receptor beta 93.74
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 93.74
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.74
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 93.73
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 93.7
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 93.69
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 93.68
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 93.67
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 93.66
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 93.63
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 93.63
2wji_A165 Ferrous iron transport protein B homolog; membrane 93.61
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 93.61
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 93.61
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 93.6
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 93.6
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 93.59
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.59
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 93.55
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.53
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 93.51
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 93.51
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 93.5
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 93.47
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 93.44
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 93.44
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 93.42
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 93.4
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 93.39
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 93.39
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 93.38
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 93.37
2ged_A193 SR-beta, signal recognition particle receptor beta 93.37
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 93.37
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 93.33
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 93.32
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 93.31
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 93.31
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 93.28
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 93.28
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.27
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 93.25
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 93.24
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 93.22
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 93.22
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 93.21
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 93.17
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 93.17
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 93.16
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 93.16
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 93.15
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 93.14
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 93.11
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 93.09
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 93.07
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 93.04
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.04
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 93.02
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 92.97
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 92.96
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 92.96
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 92.95
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 92.93
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 92.92
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 92.92
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.91
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 92.91
2h92_A 219 Cytidylate kinase; rossmann fold, transferase; HET 92.91
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 92.91
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 92.9
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 92.88
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 92.88
1vma_A306 Cell division protein FTSY; TM0570, structural gen 92.83
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.8
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 92.8
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 92.79
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 92.79
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 92.78
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 92.76
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 92.71
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 92.7
1sgw_A214 Putative ABC transporter; structural genomics, P p 92.67
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.66
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 92.66
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 92.62
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 92.61
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 92.6
2fh5_B 214 SR-beta, signal recognition particle receptor beta 92.59
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 92.58
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 92.57
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 92.57
3kta_A182 Chromosome segregation protein SMC; structural mai 92.55
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 92.54
1g6h_A 257 High-affinity branched-chain amino acid transport 92.5
1b0u_A 262 Histidine permease; ABC transporter, transport pro 92.5
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 92.49
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 92.49
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 92.49
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 92.45
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 92.42
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 92.42
3llu_A196 RAS-related GTP-binding protein C; structural geno 92.42
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 92.4
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 92.38
2eyu_A 261 Twitching motility protein PILT; pilus retraction 92.33
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 92.32
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 92.32
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 92.31
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 92.3
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 92.3
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 92.3
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 92.29
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 92.28
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 92.28
1ji0_A 240 ABC transporter; ATP binding protein, structural g 92.27
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 92.25
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 92.24
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 92.22
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 92.2
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 92.2
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 92.18
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 92.13
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 92.11
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 92.11
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 92.1
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 92.1
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 92.06
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 92.03
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 92.0
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 92.0
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 91.99
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 91.99
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 91.98
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 91.96
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 91.95
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 91.94
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 91.91
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 91.91
3io5_A 333 Recombination and repair protein; storage dimer, i 91.9
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 91.9
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.89
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 91.85
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 91.84
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 91.8
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 91.79
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 91.77
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 91.72
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 91.69
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 91.68
2ghi_A 260 Transport protein; multidrug resistance protein, M 91.65
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 91.63
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 91.62
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 91.61
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 91.56
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 91.54
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 91.54
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 91.54
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 91.52
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 91.52
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 91.52
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 91.49
2z43_A 324 DNA repair and recombination protein RADA; archaea 91.47
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 91.33
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 91.31
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 91.29
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 91.29
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 91.27
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 91.27
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 91.27
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 91.26
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 91.24
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 91.23
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 91.21
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 91.21
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 91.18
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 91.18
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 91.17
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 91.12
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 91.11
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 91.05
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 91.03
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 91.01
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 90.96
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 90.91
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 90.87
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 90.85
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 90.85
1p9r_A 418 General secretion pathway protein E; bacterial typ 90.81
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 90.77
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 90.71
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 90.67
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 90.66
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 90.61
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.6
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 90.56
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 90.54
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 90.51
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 90.39
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 90.37
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 90.34
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 90.29
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 90.22
2hf9_A226 Probable hydrogenase nickel incorporation protein 90.1
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 90.08
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 89.8
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 89.79
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 89.28
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 89.73
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 89.68
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 89.66
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 89.61
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 89.55
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 89.55
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 89.52
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 89.5
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 89.48
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 89.42
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 89.33
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 89.31
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 89.3
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 89.27
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 89.26
1u94_A 356 RECA protein, recombinase A; homologous recombinat 89.25
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 89.08
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 89.07
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 89.06
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 89.06
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 89.03
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 88.94
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 88.93
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 88.89
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 88.87
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 88.86
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 88.85
1xjc_A169 MOBB protein homolog; structural genomics, midwest 88.85
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 88.8
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 88.75
4djt_A 218 GTP-binding nuclear protein GSP1; structural genom 88.72
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 88.71
2og2_A359 Putative signal recognition particle receptor; nuc 88.65
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 88.64
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 88.61
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 88.6
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 88.52
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 88.46
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 88.45
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 88.42
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 88.23
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 88.18
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 88.17
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 88.08
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 88.03
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 88.0
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 87.99
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 87.87
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 87.78
2orv_A 234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 87.77
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 87.71
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 87.69
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 87.58
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 87.32
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 87.18
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 87.16
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 87.03
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 86.69
1xp8_A 366 RECA protein, recombinase A; recombination, radior 86.58
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 86.52
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 86.5
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 86.3
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 86.27
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 86.24
4edh_A 213 DTMP kinase, thymidylate kinase; structural genomi 86.2
3o47_A329 ADP-ribosylation factor GTPase-activating protein 86.2
3cnl_A262 YLQF, putative uncharacterized protein; circular p 86.04
1yks_A 440 Genome polyprotein [contains: flavivirin protease 86.03
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 86.01
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 86.0
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 85.93
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 85.91
2r6a_A 454 DNAB helicase, replicative helicase; replication, 85.82
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 85.74
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 85.72
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 85.69
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 85.66
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 85.4
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
Probab=100.00  E-value=7.2e-62  Score=493.70  Aligned_cols=328  Identities=38%  Similarity=0.620  Sum_probs=289.8

Q ss_pred             ccccccCCCCCCCCcEEEEEEEEEEecCCceEEEEEEEEeCC--CCcEEEEeecccccccccCCcCCCCCCCCCCC-Cee
Q psy1366           6 QLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTK--CKQCFYVKADFEQFYSIANPLSCGSPSSCDGT-NFS   82 (345)
Q Consensus         6 ~~~~~~~~~s~~igkLV~i~G~Vir~s~vk~~~~~~~f~C~~--C~~~~~~~~~~~~~~~~~~p~~C~~~~~C~~~-~f~   82 (345)
                      .....|.+++.++||||+|+|+|+|+|.++|++.+++|.|.+  ||+.+.++.+....+.+.+|..||   .|+++ +|.
T Consensus        99 ~~~~~r~l~~~~i~~lv~v~G~V~r~s~v~~~~~~~~~~C~~~~C~~~~~~~~~~~~~~~~~~p~~C~---~C~~~~~~~  175 (595)
T 3f9v_A           99 RVIELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVLEMPTICP---KCGKPGQFR  175 (595)
T ss_dssp             CEECGGGCCGGGTTCCEEEEEEEEEECCCEEEEEECCCEEESSSCCCBCCSSCSSCCCSSCCCCSSCT---TTCCCSEEE
T ss_pred             CCCChhhcchhhCCcEEEEEEEEEEecCEEEEEEEEEEEecCCCCCCEEEEEeccccCCcccCCCcCC---CCCCCCceE
Confidence            445567789999999999999999999999999999999999  999876543222345789999997   59986 566


Q ss_pred             eeecCCCCceeeeeeEEEeeec--CCCCCCceEEEEEEecCccccccCCCEEEEEEEEeeeeeec-ccCccceeEEEeee
Q psy1366          83 PVTSVDQDNYKDYQEIKIQERA--AGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWRPV-VKGVRSDIELCLSA  159 (345)
Q Consensus        83 ~l~~~~~~~~~d~Q~IriQE~~--~~~g~~prsi~V~l~~dlv~~~~pGd~V~i~Gil~~~~~~~-~~~~~~~~~~~i~a  159 (345)
                      ++  .+.+.|+|||+|+|||.+  .|.|++||+++|+|++||||.|+|||+|.|+||++..|... ..+..+.++++++|
T Consensus       176 ~~--~~~s~~~d~Q~i~iQe~~~~~~~g~~pr~~~v~l~~dlv~~~~pGd~v~v~Gi~~~~~~~~~~~~~~~~~~~~i~a  253 (595)
T 3f9v_A          176 LI--PEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPGDRVKVTGILDIKQDSPVKRGSRAVFDIYMKV  253 (595)
T ss_dssp             CC--STTCEEEEEEEEEEECCTTTSCTTSCCCEEEEEEEGGGTTCSCSSCEEEEEEECCCCCSSTTSCTTCCCCCCCCEE
T ss_pred             Ee--ccCceeeeeEEEEEEeccccCCCCCCCceEEEEEecccccccccCCEEEEEEEEEecccccccCCCcceEEEEEEE
Confidence            66  567889999999999999  88999999999999999999999999999999999876542 23446789999999


Q ss_pred             ceeeeeccCCCCcccCHHHHHHHHHHHHhhccChhhHHHHHHhccCcccccchHHHHHHHHHHhCCCcccCCCCCceeee
Q psy1366         160 NYLTVCNDQSSSLVITPELRAEVTQFWEDHKYDGLAARNHILASICPAIYGLYLVKLCLAVVLAGGVGRGGEDGSKVRAE  239 (345)
Q Consensus       160 ~~i~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~l~~s~~p~i~G~~~vk~~i~l~l~~g~~~~~~~~~~~r~~  239 (345)
                      ++|+..+.......+++++++++.++++    ++. .++.+.++++|.|+|++.+|+++++++++|..+...+ ..+|++
T Consensus       254 ~~i~~~~~~~~~~~~t~~~~~~i~~~~~----~~~-~~~~l~~~l~~~I~G~e~vk~al~~~l~~g~~~~~~~-~~~r~~  327 (595)
T 3f9v_A          254 SSIEVSQKVLDEVIISEEDEKKIKDLAK----DPW-IRDRIISSIAPSIYGHWELKEALALALFGGVPKVLED-TRIRGD  327 (595)
T ss_dssp             EEEEECCCCCCCCCCTTSTHHHHHTTSS----TTT-GGGTHHHHTSSTTSCCHHHHHHHTTTTTCCCCEETTT-TEECCS
T ss_pred             EeecccccccccCCCCHHHHHHHHHHhh----CcH-HHHHHHHhhcchhcChHHHHHHHHHHHhCCCcccccC-CCcCCC
Confidence            9999888777777888888888877653    222 2478999999999999999999999999998887777 899999


Q ss_pred             eceeeeCCCCChHHHHHHHHHhhCCCeEEEcCCccCcCCceEEEEee--cCeeEeeeceeeecCCcEEEEcCCCCCCHHh
Q psy1366         240 SHLLLVGDPGTGKSEILKFAKRMSPRSVLTTGVGTTTAGLTVSALRE--NGEWHLEAGALVLSDGGVCCIDEFSSIKEHD  317 (345)
Q Consensus       240 ~~iLl~G~pGtGKs~l~~~i~~~~~~~~~~~~~~~~~~glt~~~~~~--~~~~~~~~G~l~la~~gi~~IDEidk~~~~~  317 (345)
                      +|+||+||||||||+||+++++.+++..+..+.+++.+|++++..++  .+.|..++|++.+|++|||||||||+|+++.
T Consensus       328 ~~vLL~GppGtGKT~LAr~la~~~~r~~~~~~~~~~~~~l~~~~~~~~~~g~~~~~~G~l~~A~~gil~IDEid~l~~~~  407 (595)
T 3f9v_A          328 IHILIIGDPGTAKSQMLQFISRVAPRAVYTTGKGSTAAGLTAAVVREKGTGEYYLEAGALVLADGGIAVIDEIDKMRDED  407 (595)
T ss_dssp             CCEEEEESSCCTHHHHHHSSSTTCSCEECCCTTCSTTTTSEEECSSGGGTSSCSEEECHHHHHSSSEECCTTTTCCCSHH
T ss_pred             cceEEECCCchHHHHHHHHHHHhCCCceecCCCccccccccceeeeccccccccccCCeeEecCCCcEEeehhhhCCHhH
Confidence            99999999999999999999999999999988888889999988776  4788899999999999999999999999999


Q ss_pred             HHHHHHHHhCCEEEEeeCCeEEEeccC
Q psy1366         318 RTSIHEAMEQQTISVAKDKESKKVKVK  344 (345)
Q Consensus       318 ~~~l~eame~~~i~i~k~gi~~~l~ar  344 (345)
                      |++|+++||+|++++.++|...++++|
T Consensus       408 q~~Ll~~le~~~i~i~~~g~~~~~~~~  434 (595)
T 3f9v_A          408 RVAIHEAMEQQTVSIAKAGIVAKLNAR  434 (595)
T ss_dssp             HHHHHHHHHSSSEEEESSSSEEEECCC
T ss_pred             hhhhHHHHhCCEEEEecCCcEEEecCc
Confidence            999999999999999999999999876



>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 345
d1ltla_239 b.40.4.11 (A:) DNA replication initiator (cdc21/cd 5e-23
d1g8pa_ 333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 0.001
>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 239 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: DNA replication initiator (cdc21/cdc54) N-terminal domain
domain: DNA replication initiator (cdc21/cdc54) N-terminal domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
 Score = 93.6 bits (232), Expect = 5e-23
 Identities = 41/162 (25%), Positives = 64/162 (39%), Gaps = 14/162 (8%)

Query: 5   PQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSI 64
             +   +   ++ IG  + + G V +    +    +  + C  C +   V    +    I
Sbjct: 89  SNVIPLRELRSKFIGKFVAVDGIVRKTDEIRPRIVKAVFECRGCMRHHAV---TQSTNMI 145

Query: 65  ANPLSCGSPSSCDGTNFSPVTSVDQDNYKDYQEIKIQERAAGV--GSVPKSIWVTLEDDL 122
             P  C   S C G +F  +   D+  + D Q +K+QE    +  G  P+ I V LEDDL
Sbjct: 146 TEPSLC---SECGGRSFRLLQ--DESEFLDTQTLKLQEPLENLSGGEQPRQITVVLEDDL 200

Query: 123 VDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYLTV 164
           VD   PGD V V G +    R V        +  +  NY   
Sbjct: 201 VDTLTPGDIVRVTGTL----RTVRDERTKRFKNFIYGNYTEF 238


>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
d1ltla_239 DNA replication initiator (cdc21/cdc54) N-terminal 100.0
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.87
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.17
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 99.16
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.16
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 99.14
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 99.09
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.03
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 98.79
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.72
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.67
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.66
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.62
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.57
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 98.52
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 98.42
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.38
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.35
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.32
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.25
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.19
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.15
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.06
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.05
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 97.95
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.91
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.88
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.76
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.71
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.57
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.57
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.33
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.25
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 97.23
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.21
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.19
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.19
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.08
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.08
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.83
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.82
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.73
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.71
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.68
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.68
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.65
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.65
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.55
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.54
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.5
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.45
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.41
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.38
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.33
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.32
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.27
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.26
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.25
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.25
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.2
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.17
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.12
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.93
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.78
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.78
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.7
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.64
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 95.55
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.53
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.52
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.5
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.44
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 95.42
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.41
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.37
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.37
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.34
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.29
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.11
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 94.99
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.9
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 94.85
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.8
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.65
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.64
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.57
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.51
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 94.5
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 94.48
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.48
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 94.46
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 94.41
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 94.38
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 94.34
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.31
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 94.3
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.29
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 94.29
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 94.28
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.23
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 94.2
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.17
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 94.04
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 94.0
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.91
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.9
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.88
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.86
d2fh5b1 207 Signal recognition particle receptor beta-subunit 93.84
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 93.82
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.8
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.8
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.79
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.78
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 93.73
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 93.7
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.69
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.65
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.64
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.63
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.54
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.52
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 93.48
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 93.46
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.38
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 93.29
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.27
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 93.23
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 93.21
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 93.15
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 93.12
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.04
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 92.98
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 92.98
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 92.94
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.85
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.83
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.82
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.81
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.67
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.65
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 92.64
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 92.57
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 92.55
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.5
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 92.48
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 92.46
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 92.44
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.37
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 92.29
d2awna2232 Maltose transport protein MalK, N-terminal domain 92.28
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 92.19
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 92.14
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 92.07
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 92.01
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.01
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 91.97
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.87
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 91.86
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.78
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 91.76
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.76
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 91.7
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 91.69
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 91.61
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 91.61
d1g2912 240 Maltose transport protein MalK, N-terminal domain 91.51
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 91.48
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 91.47
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 91.34
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.26
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 90.92
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.85
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 90.81
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 90.78
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 90.7
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 90.46
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 90.46
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 90.19
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 90.07
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.04
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.92
d1ls1a2207 GTPase domain of the signal sequence recognition p 89.88
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 89.74
d1okkd2207 GTPase domain of the signal recognition particle r 89.64
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 89.63
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 89.51
d1j8yf2211 GTPase domain of the signal sequence recognition p 89.43
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 89.39
d1vmaa2213 GTPase domain of the signal recognition particle r 89.39
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 89.35
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 89.3
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.3
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 89.12
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 89.12
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 89.01
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 88.98
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.92
d2qy9a2211 GTPase domain of the signal recognition particle r 88.88
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 88.17
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 88.15
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 88.13
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 87.92
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.87
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 87.87
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.77
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 87.76
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 87.59
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 87.31
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 87.06
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 87.05
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 86.57
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 86.55
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 86.37
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 86.18
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 85.89
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 85.52
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.45
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 85.08
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 84.9
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 84.86
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 84.86
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 84.53
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 84.5
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 84.42
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 83.92
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 81.73
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 81.36
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 81.08
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 80.81
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 80.79
d1xpua3 289 Transcription termination factor Rho, ATPase domai 80.16
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 80.06
>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: DNA replication initiator (cdc21/cdc54) N-terminal domain
domain: DNA replication initiator (cdc21/cdc54) N-terminal domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=100.00  E-value=2.3e-32  Score=245.00  Aligned_cols=148  Identities=26%  Similarity=0.401  Sum_probs=130.1

Q ss_pred             cccccccCCCCCCCCcEEEEEEEEEEecCCceEEEEEEEEeCCCCcEEEEeecccccccccCCcCCCCCCCCCCCCeeee
Q psy1366           5 PQLHRTQFPNNEDIGSLLQISGTVVRITVAKMLEFRREYVCTKCKQCFYVKADFEQFYSIANPLSCGSPSSCDGTNFSPV   84 (345)
Q Consensus         5 ~~~~~~~~~~s~~igkLV~i~G~Vir~s~vk~~~~~~~f~C~~C~~~~~~~~~~~~~~~~~~p~~C~~~~~C~~~~f~~l   84 (345)
                      |.....|.+++.++||||+++|+|+|+|+++|++.+++|+|.+||+.+.+...   .+.+.+|..|+   .|++++|.++
T Consensus        89 ~~~~~ir~l~s~~igkLv~v~GiV~r~s~v~~~~~~~~~~C~~C~~~~~~~~~---~~~~~~p~~C~---~C~~~~f~~~  162 (239)
T d1ltla_          89 SNVIPLRELRSKFIGKFVAVDGIVRKTDEIRPRIVKAVFECRGCMRHHAVTQS---TNMITEPSLCS---ECGGRSFRLL  162 (239)
T ss_dssp             SCBCCGGGCCGGGTTSEEEEEEEEEEECCCEEEEEEEEEEETTTCCEEEEECS---SSSCCCCSCCT---TTCCCCEEEC
T ss_pred             CCccchhccchhhhccEEEEEEEEEEeCCEEEEEEEEEEECCCCCceEEEEec---CCeecCCccCC---CCCCcccEEc
Confidence            44556778999999999999999999999999999999999999999877553   45678999996   6999999887


Q ss_pred             ecCCCCceeeeeeEEEeeec--CCCCCCceEEEEEEecCccccccCCCEEEEEEEEeeeeeecccCccceeEEEeeecee
Q psy1366          85 TSVDQDNYKDYQEIKIQERA--AGVGSVPKSIWVTLEDDLVDLARPGDDVIVCGAVLRRWRPVVKGVRSDIELCLSANYL  162 (345)
Q Consensus        85 ~~~~~~~~~d~Q~IriQE~~--~~~g~~prsi~V~l~~dlv~~~~pGd~V~i~Gil~~~~~~~~~~~~~~~~~~i~a~~i  162 (345)
                        .+.+.|+|||+|+|||++  ++.|++||+++|+|++||||+++|||+|.|+|||+...    .+....++.+++|+||
T Consensus       163 --~~~s~~~d~Q~i~iQE~~e~~~~G~~Pr~i~v~l~~dlvd~~~pGd~V~i~GI~~~~~----~~~~~~~~~~i~a~~I  236 (239)
T d1ltla_         163 --QDESEFLDTQTLKLQEPLENLSGGEQPRQITVVLEDDLVDTLTPGDIVRVTGTLRTVR----DERTKRFKNFIYGNYT  236 (239)
T ss_dssp             --GGGCEEEEEEEEEEECCSTTCCSSCCCCEEEEEEEGGGTTCCCTTCEEEEEEEEEEEE----ETTTTEEEEEEEEEEC
T ss_pred             --cCcceEeeeEEEEEecccccCCCCCCCcEEEEEEeccccCccCCCCEEEEEEEEEEee----cCCCCceEEEEEEEEE
Confidence              457889999999999999  88999999999999999999999999999999997543    2334568899999999


Q ss_pred             ee
Q psy1366         163 TV  164 (345)
Q Consensus       163 ~~  164 (345)
                      +.
T Consensus       237 e~  238 (239)
T d1ltla_         237 EF  238 (239)
T ss_dssp             CB
T ss_pred             EE
Confidence            75



>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure