Diaphorina citri psyllid: psy13682

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MTTLRAFTCDDMFKFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPTGEIMGYIMGKAEGHGDKWHGHVTALTVAPDYRRLGIAAELMSWLEDISEKKRAYFVDLFVRVSNTVAITMYKRLGYIVYRTVLEYYSGSPDEDAYDMRKALSRDVHGKSVIPLKQAVRPEDVDNY
ccCEECcccccHHHHHHHcccccccccccHHHHHHHHcccccEEEEEcccccEEEEEEEEECcccccCEEEEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHccccccccccccccccccccccccc
MTTLRAFTCDDMFKFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPTGEIMGYIMGKAEGHGDKWHGHVTALTVAPDYRRLGIAAELMSWLEDISEKKRAYFVDLFVRVSNTVAITMYKRLGYIVYRTVLEYYSGSPDEDAYDMRKALS***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTLRAFTCDDMFKFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPTGEIMGYIMGKAEGHGDKWHGHVTALTVAPDYRRLGIAAELMSWLEDISEKKRAYFVDLFVRVSNTVAITMYKRLGYIVYRTVLEYYSGSPDEDAYDMRKALSRDVHGKSVIPLKQAVRPEDVDNY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-alpha-acetyltransferase 20 Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp-Glu. May play a role in normal cell-cycle progression.very confidentQ6P632
N-alpha-acetyltransferase 20 Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp-Glu. May play a role in normal cell-cycle progression.very confidentP61600
N-alpha-acetyltransferase 20 Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp-Glu. May play a role in normal cell-cycle progression.very confidentP61599

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004596 [MF]peptide alpha-N-acetyltransferase activityconfidentGO:0034212, GO:0008080, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674
GO:0017196 [BP]N-terminal peptidyl-methionine acetylationprobableGO:0043543, GO:0044238, GO:0008152, GO:0044260, GO:0044267, GO:0019538, GO:0044237, GO:0006473, GO:0018206, GO:0006474, GO:0018193, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0006464, GO:0031365, GO:0009987
GO:0019186 [MF]acyl-CoA N-acyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016747, GO:0016410, GO:0016746
GO:0031416 [CC]NatB complexprobableGO:0031248, GO:0005737, GO:0032991, GO:0044464, GO:0031414, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043234
GO:0007010 [BP]cytoskeleton organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044351 [BP]macropinocytosisprobableGO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0001676 [BP]long-chain fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0002213 [BP]defense response to insectprobableGO:0009607, GO:0050896, GO:0009625, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0006633 [BP]fatty acid biosynthetic processprobableGO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0007005 [BP]mitochondrion organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0031415 [CC]NatA complexprobableGO:0031248, GO:0005737, GO:0032991, GO:0044464, GO:0031414, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043234
GO:0040007 [BP]growthprobableGO:0008150
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.88Peptide alpha-N-acetyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OB0, chain A
Confidence level:very confident
Coverage over the Query: 1-151
View the alignment between query and template
View the model in PyMOL