Psyllid ID: psy13682
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 175 | ||||||
| 332373340 | 173 | unknown [Dendroctonus ponderosae] | 0.988 | 1.0 | 0.861 | 1e-84 | |
| 189236619 | 173 | PREDICTED: similar to n-acetyltransferas | 0.988 | 1.0 | 0.855 | 3e-84 | |
| 158301515 | 173 | AGAP001878-PA [Anopheles gambiae str. PE | 0.988 | 1.0 | 0.843 | 1e-83 | |
| 307177768 | 173 | N-acetyltransferase 5 [Camponotus florid | 0.988 | 1.0 | 0.832 | 3e-83 | |
| 156536864 | 173 | PREDICTED: N-alpha-acetyltransferase 20, | 0.988 | 1.0 | 0.832 | 3e-83 | |
| 322786062 | 173 | hypothetical protein SINV_04818 [Solenop | 0.988 | 1.0 | 0.832 | 4e-83 | |
| 357614028 | 173 | N-acetyltransferase [Danaus plexippus] | 0.988 | 1.0 | 0.838 | 9e-83 | |
| 307199371 | 173 | N-acetyltransferase 5 [Harpegnathos salt | 0.988 | 1.0 | 0.832 | 3e-82 | |
| 242010439 | 173 | N-acetyltransferase, putative [Pediculus | 0.988 | 1.0 | 0.826 | 3e-82 | |
| 170044510 | 173 | N-acetyltransferase 5 [Culex quinquefasc | 0.988 | 1.0 | 0.832 | 4e-82 |
| >gi|332373340|gb|AEE61811.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
Score = 317 bits (811), Expect = 1e-84, Method: Compositional matrix adjust.
Identities = 149/173 (86%), Positives = 160/173 (92%)
Query: 1 MTTLRAFTCDDMFKFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPTGEIMGYIMGK 60
MTTLR FTCDDM++FNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESP+GEIMGYIMGK
Sbjct: 1 MTTLRPFTCDDMYRFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPSGEIMGYIMGK 60
Query: 61 AEGHGDKWHGHVTALTVAPDYRRLGIAAELMSWLEDISEKKRAYFVDLFVRVSNTVAITM 120
AEG GD WHGHVTALTV+PDYRRLG+AA LM++LE++SEKKRAYFVDLFVRVSN VAI M
Sbjct: 61 AEGVGDNWHGHVTALTVSPDYRRLGLAANLMNYLEEVSEKKRAYFVDLFVRVSNQVAIKM 120
Query: 121 YKRLGYIVYRTVLEYYSGSPDEDAYDMRKALSRDVHGKSVIPLKQAVRPEDVD 173
Y LGYIVYRTVLEYYSG PDEDAYDMRKALSRDV+ KSVIPL VRPE+VD
Sbjct: 121 YTNLGYIVYRTVLEYYSGDPDEDAYDMRKALSRDVNQKSVIPLDHPVRPEEVD 173
|
Source: Dendroctonus ponderosae Species: Dendroctonus ponderosae Genus: Dendroctonus Family: Curculionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189236619|ref|XP_001816527.1| PREDICTED: similar to n-acetyltransferase [Tribolium castaneum] gi|270005230|gb|EFA01678.1| hypothetical protein TcasGA2_TC007251 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|158301515|ref|XP_321189.4| AGAP001878-PA [Anopheles gambiae str. PEST] gi|157012509|gb|EAA01680.4| AGAP001878-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|307177768|gb|EFN66765.1| N-acetyltransferase 5 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|156536864|ref|XP_001604565.1| PREDICTED: N-alpha-acetyltransferase 20, NatB catalytic subunit-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|322786062|gb|EFZ12673.1| hypothetical protein SINV_04818 [Solenopsis invicta] gi|332019327|gb|EGI59833.1| N-terminal acetyltransferase B complex catalytic subunit NAT5 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|357614028|gb|EHJ68864.1| N-acetyltransferase [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|307199371|gb|EFN79996.1| N-acetyltransferase 5 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242010439|ref|XP_002425975.1| N-acetyltransferase, putative [Pediculus humanus corporis] gi|212509966|gb|EEB13237.1| N-acetyltransferase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|170044510|ref|XP_001849888.1| N-acetyltransferase 5 [Culex quinquefasciatus] gi|167867628|gb|EDS31011.1| N-acetyltransferase 5 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 175 | ||||||
| FB|FBgn0031043 | 175 | NAA20 "NAA20 ortholog" [Drosop | 0.988 | 0.988 | 0.815 | 2.5e-74 | |
| ZFIN|ZDB-GENE-050327-47 | 178 | naa20 "N(alpha)-acetyltransfer | 0.988 | 0.971 | 0.741 | 3.3e-70 | |
| UNIPROTKB|E1C474 | 178 | NAA20 "Uncharacterized protein | 0.988 | 0.971 | 0.741 | 7e-70 | |
| UNIPROTKB|P61599 | 178 | NAA20 "N-alpha-acetyltransfera | 0.988 | 0.971 | 0.735 | 8.9e-70 | |
| MGI|MGI:1915127 | 178 | Naa20 "N(alpha)-acetyltransfer | 0.988 | 0.971 | 0.735 | 8.9e-70 | |
| UNIPROTKB|J9P2S9 | 188 | NAA20 "Uncharacterized protein | 0.988 | 0.920 | 0.696 | 3.1e-67 | |
| UNIPROTKB|E1B843 | 188 | NAA20 "Uncharacterized protein | 0.988 | 0.920 | 0.691 | 8.2e-67 | |
| RGD|1307713 | 188 | Naa20 "N(alpha)-acetyltransfer | 0.988 | 0.920 | 0.691 | 8.2e-67 | |
| UNIPROTKB|A8MZB2 | 166 | NAA20 "N-alpha-acetyltransfera | 0.885 | 0.933 | 0.725 | 3.9e-60 | |
| TAIR|locus:2007584 | 174 | AT1G03150 "AT1G03150" [Arabido | 0.977 | 0.982 | 0.637 | 9.3e-59 |
| FB|FBgn0031043 NAA20 "NAA20 ortholog" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 750 (269.1 bits), Expect = 2.5e-74, P = 2.5e-74
Identities = 141/173 (81%), Positives = 152/173 (87%)
Query: 1 MTTLRAFTCDDMFKFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPTGEIMGYIMGK 60
MTTLR FTCDD+FKFNNVN DPLTETYGLSFY QYLA WPEYFQ+AESP+G+IMGYIMGK
Sbjct: 1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGK 60
Query: 61 AEGHGDKWHGHVTALTVAPDYRRLGIAAELMSWLEDISEKKRAYFVDLFVRVSNTVAITM 120
EGH D WHGHVTALTV+PDYRRLG+AA LMS+LEDISEKKRAYFVDLFVR SN VAI M
Sbjct: 61 VEGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINM 120
Query: 121 YKRLGYIVYRTVLEYYSGSPDEDAYDMRKALSRDVHGKSVIPLKQAVRPEDVD 173
Y LGYI+YRT+LEYYSG DEDAYDMRKALSRDV+ KSVIP Q VR E +D
Sbjct: 121 YTNLGYIIYRTILEYYSGDQDEDAYDMRKALSRDVNKKSVIPYTQPVRLEHID 173
|
|
| ZFIN|ZDB-GENE-050327-47 naa20 "N(alpha)-acetyltransferase 20, NatB catalytic subunit" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C474 NAA20 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P61599 NAA20 "N-alpha-acetyltransferase 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915127 Naa20 "N(alpha)-acetyltransferase 20, NatB catalytic subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P2S9 NAA20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B843 NAA20 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1307713 Naa20 "N(alpha)-acetyltransferase 20, NatB catalytic subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8MZB2 NAA20 "N-alpha-acetyltransferase 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2007584 AT1G03150 "AT1G03150" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 175 | |||
| COG0456 | 177 | COG0456, RimI, Acetyltransferases [General functio | 1e-24 | |
| pfam00583 | 80 | pfam00583, Acetyltransf_1, Acetyltransferase (GNAT | 4e-16 | |
| TIGR01575 | 131 | TIGR01575, rimI, ribosomal-protein-alanine acetylt | 5e-15 | |
| PRK03624 | 140 | PRK03624, PRK03624, putative acetyltransferase; Pr | 5e-13 | |
| cd04301 | 65 | cd04301, NAT_SF, N-Acyltransferase superfamily: Va | 5e-08 | |
| pfam08445 | 86 | pfam08445, FR47, FR47-like protein | 7e-06 | |
| pfam13508 | 79 | pfam13508, Acetyltransf_7, Acetyltransferase (GNAT | 7e-06 | |
| COG3393 | 268 | COG3393, COG3393, Predicted acetyltransferase [Gen | 9e-06 | |
| TIGR03103 | 547 | TIGR03103, trio_acet_GNAT, GNAT-family acetyltrans | 1e-04 | |
| PRK09491 | 146 | PRK09491, rimI, ribosomal-protein-alanine N-acetyl | 2e-04 | |
| PTZ00330 | 147 | PTZ00330, PTZ00330, acetyltransferase; Provisional | 6e-04 | |
| PRK10975 | 194 | PRK10975, PRK10975, TDP-fucosamine acetyltransfera | 0.001 | |
| pfam13673 | 118 | pfam13673, Acetyltransf_10, Acetyltransferase (GNA | 0.001 | |
| PRK10146 | 144 | PRK10146, PRK10146, aminoalkylphosphonic acid N-ac | 0.002 | |
| pfam13527 | 127 | pfam13527, Acetyltransf_9, Acetyltransferase (GNAT | 0.002 |
| >gnl|CDD|223532 COG0456, RimI, Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
Score = 93.9 bits (233), Expect = 1e-24
Identities = 45/164 (27%), Positives = 71/164 (43%), Gaps = 14/164 (8%)
Query: 1 MTTLRAFTCDDMFKFNNVNLDPLTET----YGLSFYMQYLAHWPEYFQVAES------PT 50
T+R D+ L+ T + ++ + L PE VAE+
Sbjct: 11 KVTIREAINKDLLDVALAALEARTFDIRLPWSREYFEKDLTQAPELLLVAETGGLDGLLD 70
Query: 51 GEIMGYIMG--KAEGHGDKWHGHVTALTVAPDYRRLGIAAELMS-WLEDISEKKRAYFVD 107
G+++G+++ GH+ L V P+YR GI L+ LE + E+ A +
Sbjct: 71 GKVVGFLLVRVVDGRPSADHEGHIYNLAVDPEYRGRGIGRALLDEALERLRERGLADKIV 130
Query: 108 LFVRVSNTVAITMYKRLGYIVYRTVLEYYSGSPDEDAYDMRKAL 151
L VR SN AI +Y++LG+ V + YY + DA M K L
Sbjct: 131 LEVRESNEAAIGLYRKLGFEVVKIRKNYY-ADGNGDALLMLKML 173
|
Length = 177 |
| >gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family | Back alignment and domain information |
|---|
| >gnl|CDD|233477 TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|235142 PRK03624, PRK03624, putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >gnl|CDD|117022 pfam08445, FR47, FR47-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|225928 COG3393, COG3393, Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|132147 TIGR03103, trio_acet_GNAT, GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >gnl|CDD|181904 PRK09491, rimI, ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140351 PTZ00330, PTZ00330, acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182877 PRK10975, PRK10975, TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222309 pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|182266 PRK10146, PRK10146, aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222199 pfam13527, Acetyltransf_9, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| KOG3234|consensus | 173 | 99.95 | ||
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 99.93 | |
| KOG3139|consensus | 165 | 99.91 | ||
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 99.91 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 99.91 | |
| KOG3235|consensus | 193 | 99.89 | ||
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 99.89 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 99.89 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 99.88 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 99.88 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 99.87 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 99.86 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 99.86 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 99.86 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 99.85 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 99.85 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 99.85 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 99.85 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 99.84 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 99.83 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 99.83 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 99.82 | |
| KOG3216|consensus | 163 | 99.82 | ||
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 99.82 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 99.82 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 99.81 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 99.81 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 99.81 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 99.8 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 99.8 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 99.77 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 99.77 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 99.76 | |
| COG1246 | 153 | ArgA N-acetylglutamate synthase and related acetyl | 99.76 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 99.76 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 99.76 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 99.76 | |
| COG3153 | 171 | Predicted acetyltransferase [General function pred | 99.76 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 99.75 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 99.75 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 99.75 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 99.75 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 99.73 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 99.72 | |
| PHA01807 | 153 | hypothetical protein | 99.71 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 99.71 | |
| KOG3138|consensus | 187 | 99.7 | ||
| PRK01346 | 411 | hypothetical protein; Provisional | 99.68 | |
| KOG3396|consensus | 150 | 99.67 | ||
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 99.6 | |
| KOG2488|consensus | 202 | 99.59 | ||
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 99.58 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 99.57 | |
| COG3981 | 174 | Predicted acetyltransferase [General function pred | 99.57 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 99.53 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 99.52 | |
| COG2153 | 155 | ElaA Predicted acyltransferase [General function p | 99.49 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 99.46 | |
| KOG3397|consensus | 225 | 99.45 | ||
| PF12746 | 265 | GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S | 99.33 | |
| PF13718 | 196 | GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z | 99.31 | |
| PF08444 | 89 | Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt | 99.18 | |
| KOG4144|consensus | 190 | 99.17 | ||
| TIGR01211 | 522 | ELP3 histone acetyltransferase, ELP3 family. The S | 99.15 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 99.1 | |
| PF12568 | 128 | DUF3749: Acetyltransferase (GNAT) domain; InterPro | 98.99 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 98.99 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 98.96 | |
| COG3375 | 266 | Uncharacterized conserved protein [Function unknow | 98.93 | |
| KOG4135|consensus | 185 | 98.83 | ||
| COG3818 | 167 | Predicted acetyltransferase, GNAT superfamily [Gen | 98.82 | |
| COG2388 | 99 | Predicted acetyltransferase [General function pred | 98.69 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 98.62 | |
| COG4552 | 389 | Eis Predicted acetyltransferase involved in intrac | 98.53 | |
| PF04958 | 342 | AstA: Arginine N-succinyltransferase beta subunit; | 98.43 | |
| PRK10456 | 344 | arginine succinyltransferase; Provisional | 98.39 | |
| COG5628 | 143 | Predicted acetyltransferase [General function pred | 98.25 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 98.23 | |
| PF00765 | 182 | Autoind_synth: Autoinducer synthetase; InterPro: I | 98.15 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 98.13 | |
| PRK13834 | 207 | putative autoinducer synthesis protein; Provisiona | 98.06 | |
| PF06852 | 181 | DUF1248: Protein of unknown function (DUF1248); In | 98.05 | |
| PF13480 | 142 | Acetyltransf_6: Acetyltransferase (GNAT) domain | 97.97 | |
| KOG3698|consensus | 891 | 97.96 | ||
| COG3916 | 209 | LasI N-acyl-L-homoserine lactone synthetase [Signa | 97.86 | |
| TIGR03244 | 336 | arg_catab_AstA arginine N-succinyltransferase. In | 97.83 | |
| TIGR03245 | 336 | arg_AOST_alph arginine/ornithine succinyltransfera | 97.8 | |
| TIGR03694 | 241 | exosort_acyl putative PEP-CTERM/exosortase system- | 97.78 | |
| TIGR03243 | 335 | arg_catab_AOST arginine and ornithine succinyltran | 97.74 | |
| COG3138 | 336 | AstA Arginine/ornithine N-succinyltransferase beta | 97.68 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 97.62 | |
| PF01233 | 162 | NMT: Myristoyl-CoA:protein N-myristoyltransferase, | 97.59 | |
| PF09390 | 161 | DUF1999: Protein of unknown function (DUF1999); In | 97.58 | |
| PF13880 | 70 | Acetyltransf_13: ESCO1/2 acetyl-transferase | 97.54 | |
| COG1243 | 515 | ELP3 Histone acetyltransferase [Transcription / Ch | 97.41 | |
| PHA00432 | 137 | internal virion protein A | 97.34 | |
| KOG2036|consensus | 1011 | 97.32 | ||
| TIGR03019 | 330 | pepcterm_femAB FemAB-related protein, PEP-CTERM sy | 97.29 | |
| PF04377 | 128 | ATE_C: Arginine-tRNA-protein transferase, C termin | 97.27 | |
| PRK01305 | 240 | arginyl-tRNA-protein transferase; Provisional | 97.12 | |
| PF05301 | 120 | Mec-17: Touch receptor neuron protein Mec-17; Inte | 97.12 | |
| PF11039 | 151 | DUF2824: Protein of unknown function (DUF2824); In | 97.05 | |
| cd04264 | 99 | DUF619-NAGS DUF619 domain of various N-acetylgluta | 96.92 | |
| KOG2535|consensus | 554 | 96.85 | ||
| PHA01733 | 153 | hypothetical protein | 96.75 | |
| PF01853 | 188 | MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i | 96.64 | |
| cd04265 | 99 | DUF619-NAGS-U DUF619 domain of various N-acetylglu | 96.44 | |
| PF02799 | 190 | NMT_C: Myristoyl-CoA:protein N-myristoyltransferas | 96.35 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 96.24 | |
| PF02474 | 196 | NodA: Nodulation protein A (NodA); InterPro: IPR00 | 96.23 | |
| PF04768 | 170 | DUF619: Protein of unknown function (DUF619); Inte | 96.21 | |
| KOG4601|consensus | 264 | 96.13 | ||
| KOG2779|consensus | 421 | 95.73 | ||
| PF11124 | 304 | Pho86: Inorganic phosphate transporter Pho86; Inte | 95.66 | |
| PLN03238 | 290 | probable histone acetyltransferase MYST; Provision | 95.61 | |
| PRK00756 | 196 | acyltransferase NodA; Provisional | 95.55 | |
| COG2935 | 253 | Putative arginyl-tRNA:protein arginylyltransferase | 95.54 | |
| COG5630 | 495 | ARG2 Acetylglutamate synthase [Amino acid transpor | 95.53 | |
| PTZ00064 | 552 | histone acetyltransferase; Provisional | 95.1 | |
| PLN03239 | 351 | histone acetyltransferase; Provisional | 94.94 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 94.9 | |
| KOG2779|consensus | 421 | 94.66 | ||
| PLN00104 | 450 | MYST -like histone acetyltransferase; Provisional | 94.39 | |
| PF02388 | 406 | FemAB: FemAB family; InterPro: IPR003447 The femAB | 94.16 | |
| PF13444 | 101 | Acetyltransf_5: Acetyltransferase (GNAT) domain | 94.16 | |
| PF09924 | 299 | DUF2156: Uncharacterized conserved protein (DUF215 | 94.08 | |
| PF11090 | 86 | DUF2833: Protein of unknown function (DUF2833); In | 92.56 | |
| KOG2747|consensus | 396 | 92.54 | ||
| cd04266 | 108 | DUF619-NAGS-FABP DUF619 domain of N-acetylglutamat | 91.8 | |
| KOG2696|consensus | 403 | 91.21 | ||
| PF12261 | 179 | T_hemolysin: Thermostable hemolysin; InterPro: IPR | 90.65 | |
| PF04339 | 370 | DUF482: Protein of unknown function, DUF482; Inter | 90.37 | |
| PRK02983 | 1094 | lysS lysyl-tRNA synthetase; Provisional | 89.12 | |
| PRK04531 | 398 | acetylglutamate kinase; Provisional | 88.63 | |
| COG5092 | 451 | NMT1 N-myristoyl transferase [Lipid metabolism] | 87.61 | |
| KOG3014|consensus | 257 | 87.23 | ||
| COG5027 | 395 | SAS2 Histone acetyltransferase (MYST family) [Chro | 87.1 | |
| PF04339 | 370 | DUF482: Protein of unknown function, DUF482; Inter | 85.36 | |
| PF07395 | 264 | Mig-14: Mig-14; InterPro: IPR009977 This family co | 84.92 | |
| COG2898 | 538 | Uncharacterized conserved protein [Function unknow | 83.28 | |
| PF12953 | 131 | DUF3842: Domain of unknown function (DUF3842); Int | 80.57 | |
| cd03173 | 98 | DUF619-like DUF619 domain of various N-acetylgluta | 80.21 |
| >KOG3234|consensus | Back alignment and domain information |
|---|
Probab=99.95 E-value=5e-27 Score=145.90 Aligned_cols=172 Identities=72% Similarity=1.169 Sum_probs=160.9
Q ss_pred CeEEeeCCcccHHHHHhcccCccccccChHHHHHHHhcCCcEEEEEEcCCCcEEEEEEeEeeCCCCeeEEEEEEEEECcc
Q psy13682 1 MTTLRAFTCDDMFKFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPTGEIMGYIMGKAEGHGDKWHGHVTALTVAPD 80 (175)
Q Consensus 1 m~~ir~~~~~d~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~ivG~~~~~~~~~~~~~~~~i~~~~V~~~ 80 (175)
|.++||++.+|+-.+-.+..+...+.++..++...+..+++.+.++...++++.|++..........|++++..+.|.|+
T Consensus 1 Mtt~r~f~~~Dlf~fNninLDpltEt~~~~Fyl~yl~~~pe~~~~a~~p~~~imgyimgk~Eg~~~~wh~HvTAltVap~ 80 (173)
T KOG3234|consen 1 MTTIRPFTPQDLFKFNNINLDPLTETFPISFYLIYLAIWPEDFIVAEAPTGEIMGYIMGKVEGKDTEWHGHVTALTVAPD 80 (173)
T ss_pred CCccccccHHHHHhhccccccccccccceehhHHHHHhChHHhEeccCCCCceEEEEeeeccccCcceeeEEEEEEechh
Confidence 67899999999999999999999999999999999999999999999888999999999888888889999999999999
Q ss_pred hhccChHHHHHHHHHHHHHHcCccEEEEEEEecCHHHHHHHHhcCcEEEEEEEeeccCCCCcceeEEEecccccCCCCcc
Q psy13682 81 YRRLGIAAELMSWLEDISEKKRAYFVDLFVRVSNTVAITMYKRLGYIVYRTVLEYYSGSPDEDAYDMRKALSRDVHGKSV 160 (175)
Q Consensus 81 ~rg~Gig~~ll~~~~~~~~~~g~~~i~~~~~~~n~~~~~~y~k~Gf~~~~~~~~~~~~~~~~~~~~m~~~l~~~~~~~~~ 160 (175)
||+.|+|+.|+..+++.....+.-.+-+.|..+|+-|+.||+++||..-.+..+||..|...|.+-|+|.|+++.++++.
T Consensus 81 ~Rrl~la~~lm~~led~~d~~~a~fvDLfVr~sN~iAI~mYkkLGY~~YR~Vi~YY~~g~deda~dMRKalSrD~dkksi 160 (173)
T KOG3234|consen 81 YRRLGLAAKLMDTLEDVSDVDNAYFVDLFVRVSNQIAIDMYKKLGYSVYRTVIEYYSVGPDEDAYDMRKALSRDVDKKSI 160 (173)
T ss_pred HHHHHHHHHHHHHHHHHHHhhhhheeeeeeeccchhHHHHHHhcCceEEEeeeeeeccCCCcchHhhhhhhccCccccee
Confidence 99999999999999999998878888889999999999999999999999999999855558999999999999999999
Q ss_pred cccCCCCCCCCC
Q psy13682 161 IPLKQAVRPEDV 172 (175)
Q Consensus 161 ~~~~~~~~~~~~ 172 (175)
+|.+.+++++++
T Consensus 161 ~~~~~~~~~~~~ 172 (173)
T KOG3234|consen 161 IPLGAPVKCSPL 172 (173)
T ss_pred ecCCCccccccC
Confidence 999999998875
|
|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3139|consensus | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3235|consensus | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >KOG3216|consensus | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >COG3153 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >KOG3138|consensus | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3396|consensus | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG2488|consensus | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3981 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2153 ElaA Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >KOG3397|consensus | Back alignment and domain information |
|---|
| >PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B | Back alignment and domain information |
|---|
| >PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B | Back alignment and domain information |
|---|
| >PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 | Back alignment and domain information |
|---|
| >KOG4144|consensus | Back alignment and domain information |
|---|
| >TIGR01211 ELP3 histone acetyltransferase, ELP3 family | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3375 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4135|consensus | Back alignment and domain information |
|---|
| >COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG2388 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine | Back alignment and domain information |
|---|
| >PRK10456 arginine succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG5628 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK13834 putative autoinducer synthesis protein; Provisional | Back alignment and domain information |
|---|
| >PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans | Back alignment and domain information |
|---|
| >PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >KOG3698|consensus | Back alignment and domain information |
|---|
| >COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR03244 arg_catab_AstA arginine N-succinyltransferase | Back alignment and domain information |
|---|
| >TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase | Back alignment and domain information |
|---|
| >TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits | Back alignment and domain information |
|---|
| >COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >PF09390 DUF1999: Protein of unknown function (DUF1999); InterPro: IPR018987 This family contains a putative Fe-S binding reductase (Q72J89 from SWISSPROT) whose structure adopts an alpha and beta fold | Back alignment and domain information |
|---|
| >PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase | Back alignment and domain information |
|---|
| >COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PHA00432 internal virion protein A | Back alignment and domain information |
|---|
| >KOG2036|consensus | Back alignment and domain information |
|---|
| >TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated | Back alignment and domain information |
|---|
| >PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein | Back alignment and domain information |
|---|
| >PRK01305 arginyl-tRNA-protein transferase; Provisional | Back alignment and domain information |
|---|
| >PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch | Back alignment and domain information |
|---|
| >PF11039 DUF2824: Protein of unknown function (DUF2824); InterPro: IPR022568 This family of proteins has no known function | Back alignment and domain information |
|---|
| >cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish | Back alignment and domain information |
|---|
| >KOG2535|consensus | Back alignment and domain information |
|---|
| >PHA01733 hypothetical protein | Back alignment and domain information |
|---|
| >PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus | Back alignment and domain information |
|---|
| >cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish | Back alignment and domain information |
|---|
| >PF02799 NMT_C: Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain; InterPro: IPR022677 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02474 NodA: Nodulation protein A (NodA); InterPro: IPR003484 Rhizobial nodulation (Nod) factors are signalling molecules secreted by root-nodulating rhizobia in response to flavanoids excreted by the host plant | Back alignment and domain information |
|---|
| >PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2 | Back alignment and domain information |
|---|
| >KOG4601|consensus | Back alignment and domain information |
|---|
| >KOG2779|consensus | Back alignment and domain information |
|---|
| >PF11124 Pho86: Inorganic phosphate transporter Pho86; InterPro: IPR024297 Pho86p is an ER protein which is produced in response to phosphate starvation | Back alignment and domain information |
|---|
| >PLN03238 probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
| >PRK00756 acyltransferase NodA; Provisional | Back alignment and domain information |
|---|
| >COG2935 Putative arginyl-tRNA:protein arginylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5630 ARG2 Acetylglutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00064 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03239 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2779|consensus | Back alignment and domain information |
|---|
| >PLN00104 MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02388 FemAB: FemAB family; InterPro: IPR003447 The femAB operon codes for two nearly identical approximately 50kDa proteins involved in the formation of the Staphylococcal pentaglycine interpeptide bridge in peptidoglycan [] | Back alignment and domain information |
|---|
| >PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >PF09924 DUF2156: Uncharacterized conserved protein (DUF2156); InterPro: IPR024320 This domain of unknown function is found in uncharacterised proteins and in Lysylphosphatidylglycerol synthetase, which catalyses the transfer of a lysyl group from L-lysyl-tRNA(Lys) to membrane-bound phosphatidylglycerol [] | Back alignment and domain information |
|---|
| >PF11090 DUF2833: Protein of unknown function (DUF2833); InterPro: IPR020335 This entry contains proteins with no known function | Back alignment and domain information |
|---|
| >KOG2747|consensus | Back alignment and domain information |
|---|
| >cd04266 DUF619-NAGS-FABP DUF619 domain of N-acetylglutamate Synthase of the fungal arginine-biosynthetic pathway | Back alignment and domain information |
|---|
| >KOG2696|consensus | Back alignment and domain information |
|---|
| >PF12261 T_hemolysin: Thermostable hemolysin; InterPro: IPR022050 This family of proteins is found in bacteria | Back alignment and domain information |
|---|
| >PF04339 DUF482: Protein of unknown function, DUF482; InterPro: IPR007434 This family contains several proteins of uncharacterised function | Back alignment and domain information |
|---|
| >PRK02983 lysS lysyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK04531 acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >COG5092 NMT1 N-myristoyl transferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG3014|consensus | Back alignment and domain information |
|---|
| >COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF04339 DUF482: Protein of unknown function, DUF482; InterPro: IPR007434 This family contains several proteins of uncharacterised function | Back alignment and domain information |
|---|
| >PF07395 Mig-14: Mig-14; InterPro: IPR009977 This family contains a number of bacterial mig-14 proteins (approximately 270 residues long) | Back alignment and domain information |
|---|
| >COG2898 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12953 DUF3842: Domain of unknown function (DUF3842); InterPro: IPR024208 This family of proteins has no known function | Back alignment and domain information |
|---|
| >cd03173 DUF619-like DUF619 domain of various N-acetylglutamate Kinases and N-acetylglutamate Synthases | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 175 | ||||
| 2x7b_A | 168 | Crystal Structure Of The N-Terminal Acetylase Ard1 | 8e-10 | ||
| 3tfy_A | 169 | Naa50p Amino-Terminal Acetyltransferase Bound To Su | 7e-06 | ||
| 2ob0_A | 170 | Human Mak3 Homolog In Complex With Acetyl-Coa Lengt | 1e-05 |
| >pdb|2X7B|A Chain A, Crystal Structure Of The N-Terminal Acetylase Ard1 From Sulfolobus Solfataricus P2 Length = 168 | Back alignment and structure |
|
| >pdb|3TFY|A Chain A, Naa50p Amino-Terminal Acetyltransferase Bound To Substrate Peptide Fragment And Coa Length = 169 | Back alignment and structure |
| >pdb|2OB0|A Chain A, Human Mak3 Homolog In Complex With Acetyl-Coa Length = 170 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 175 | |||
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 2e-60 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 7e-54 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 1e-23 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 2e-23 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 7e-21 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 6e-19 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 1e-18 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 2e-18 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 1e-17 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 2e-17 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 7e-17 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 8e-17 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 1e-16 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 3e-16 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 3e-16 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 5e-16 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 7e-16 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 7e-16 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 1e-15 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 2e-15 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 3e-15 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 9e-15 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 2e-14 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 3e-14 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 5e-14 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 1e-13 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 2e-13 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 2e-13 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 7e-13 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 7e-13 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 9e-13 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 1e-12 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 4e-12 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 5e-12 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 8e-12 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 1e-11 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 1e-11 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 1e-11 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 2e-11 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 2e-11 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 3e-11 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 3e-11 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 4e-11 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 5e-11 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 1e-10 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 2e-10 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 4e-04 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 3e-10 | |
| 2ft0_A | 235 | TDP-fucosamine acetyltransferase; GNAT fold acetyl | 3e-10 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 4e-10 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 6e-10 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 8e-10 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 9e-10 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 1e-09 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 1e-09 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 2e-09 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 2e-09 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 6e-09 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 1e-08 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 2e-08 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 2e-08 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 2e-08 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 4e-08 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 6e-08 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 8e-08 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 8e-08 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 1e-07 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 1e-07 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 1e-07 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 2e-07 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 2e-07 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 2e-07 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 4e-07 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 5e-07 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 1e-06 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 2e-06 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 2e-06 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 2e-06 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 3e-06 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 3e-06 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 4e-06 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 4e-06 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 5e-06 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 6e-06 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 7e-06 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 9e-06 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 2e-04 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 1e-05 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 2e-05 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 2e-05 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 2e-05 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 3e-05 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 3e-05 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 3e-05 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 6e-05 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 8e-05 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 1e-04 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 3e-04 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 3e-04 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 5e-04 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 6e-04 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 7e-04 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 7e-04 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 8e-04 |
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Length = 168 | Back alignment and structure |
|---|
Score = 184 bits (468), Expect = 2e-60
Identities = 49/158 (31%), Positives = 76/158 (48%), Gaps = 12/158 (7%)
Query: 3 TLRAFTCDDMFKFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPTGEIMGYIMGKAE 62
TLR DD+ + +N L E Y F++++L + F VA ++GYIM + E
Sbjct: 14 TLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAI-VDNSVVGYIMPRIE 72
Query: 63 GHGDK--------WHGHVTALTVAPDYRRLGIAAELMSW-LEDISEKKRAYFVDLFVRVS 113
GHV ++ V +YRR GIA L+ ++ + A + L VRVS
Sbjct: 73 WGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVS 132
Query: 114 NTVAITMYKRLGYIVYRTVLEYYSGSPDEDAYDMRKAL 151
N AI +Y++L + + + YY+ EDAY M + L
Sbjct: 133 NYPAIALYEKLNFKKVKVLKGYYAD--GEDAYLMARPL 168
|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Length = 170 | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Length = 144 | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Length = 160 | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Length = 187 | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Length = 160 | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Length = 182 | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177 | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Length = 312 | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158 | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 159 | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180 | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Length = 143 | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 228 | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Length = 150 | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158 | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Length = 180 | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157 | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Length = 166 | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Length = 153 | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Length = 189 | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Length = 165 | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Length = 166 | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Length = 166 | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190 | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Length = 207 | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Length = 149 | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Length = 184 | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140 | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 199 | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Length = 177 | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 162 | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Length = 176 | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Length = 170 | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Length = 197 | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Length = 165 | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 166 | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Length = 318 | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Length = 318 | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 | Back alignment and structure |
|---|
| >2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Length = 235 | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Length = 164 | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Length = 157 | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 152 | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Length = 174 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172 | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Length = 183 | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Length = 172 | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Length = 172 | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Length = 254 | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 169 | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Length = 153 | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Length = 288 | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Length = 177 | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Length = 330 | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Length = 197 | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Length = 161 | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160 | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} Length = 163 | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Length = 179 | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Length = 204 | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180 | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Length = 150 | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 149 | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Length = 170 | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Length = 162 | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Length = 181 | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Length = 152 | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Length = 224 | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Length = 146 | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Length = 147 | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Length = 163 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339 | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Length = 188 | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Length = 217 | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} Length = 215 | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Length = 238 | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Length = 171 | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190 | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Length = 133 | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Length = 188 | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Length = 222 | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} Length = 428 | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Length = 166 | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Length = 422 | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Length = 201 | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Length = 183 | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Length = 276 | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Length = 140 | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Length = 249 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 99.97 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 99.96 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 99.96 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 99.96 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 99.96 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 99.95 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 99.95 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 99.94 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 99.94 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 99.94 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 99.94 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 99.94 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 99.94 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 99.94 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 99.94 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 99.94 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 99.94 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 99.94 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 99.93 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 99.93 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 99.93 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 99.93 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 99.93 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 99.93 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 99.93 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 99.93 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 99.93 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 99.93 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 99.92 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 99.92 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 99.92 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 99.92 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 99.92 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 99.92 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 99.92 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 99.92 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 99.92 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 99.92 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 99.92 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 99.92 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 99.92 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 99.92 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 99.92 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 99.92 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 99.92 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 99.92 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 99.91 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 99.91 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 99.91 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 99.91 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 99.91 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 99.91 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 99.91 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 99.91 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 99.91 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 99.9 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 99.9 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 99.9 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 99.9 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 99.9 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 99.9 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 99.9 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 99.9 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 99.9 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 99.9 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 99.9 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 99.9 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 99.9 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 99.9 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 99.9 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 99.9 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 99.9 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 99.89 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 99.89 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 99.89 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 99.89 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 99.89 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 99.89 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 99.89 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 99.89 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 99.89 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 99.89 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 99.89 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 99.88 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 99.88 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 99.88 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 99.88 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 99.88 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 99.88 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 99.88 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 99.88 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 99.88 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 99.88 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 99.88 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 99.88 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 99.88 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 99.88 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 99.87 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 99.87 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 99.87 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 99.87 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 99.87 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 99.87 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 99.87 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 99.87 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 99.87 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 99.87 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 99.86 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 99.86 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 99.86 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 99.85 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 99.85 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 99.85 | |
| 2d4p_A | 141 | Hypothetical protein TTHA1254; structural genomics | 99.85 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 99.85 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 99.85 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 99.85 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 99.85 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 99.85 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 99.85 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 99.85 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 99.84 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 99.84 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 99.83 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 99.83 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 99.83 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 99.83 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 99.83 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 99.82 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 99.82 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 99.82 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 99.81 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 99.81 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 99.81 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 99.8 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 99.8 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 99.8 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 99.79 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 99.79 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 99.78 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 99.78 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 99.77 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 99.77 | |
| 2ft0_A | 235 | TDP-fucosamine acetyltransferase; GNAT fold acetyl | 99.76 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 99.76 | |
| 3shp_A | 176 | Putative acetyltransferase STHE_0691; PSI-biology, | 99.76 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 99.76 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 99.74 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 99.74 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 99.73 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 99.73 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 99.68 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 99.63 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 99.6 | |
| 3dns_A | 135 | Ribosomal-protein-alanine acetyltransferase; N-ter | 99.51 | |
| 1ro5_A | 201 | Autoinducer synthesis protein LASI; alpha-beta-alp | 99.39 | |
| 3p2h_A | 201 | AHL synthase; acyl-ACP binding, SAM binding, signa | 99.24 | |
| 1xmt_A | 103 | Putative acetyltransferase; structural genomics, p | 99.12 | |
| 1kzf_A | 230 | Acyl-homoserinelactone synthase ESAI; alpha-beta, | 99.08 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 99.04 | |
| 1yle_A | 342 | Arginine N-succinyltransferase, alpha chain; struc | 99.01 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 98.21 | |
| 4hkf_A | 191 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 97.66 | |
| 4b5o_A | 200 | Alpha-tubulin N-acetyltransferase; microtubules, c | 97.52 | |
| 2p0w_A | 324 | Histone acetyltransferase type B catalytic subuni; | 97.51 | |
| 3s6g_A | 460 | N-acetylglutamate kinase / N-acetylglutamate SYNT; | 97.49 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 97.33 | |
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 97.29 | |
| 4gs4_A | 240 | Alpha-tubulin N-acetyltransferase; acetyl coenzyme | 97.25 | |
| 4h6u_A | 200 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 97.14 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 97.11 | |
| 1iic_A | 422 | Peptide N-myristoyltransferase; HET: MYA; 2.20A {S | 97.1 | |
| 2wuu_A | 421 | N-myristoyltransferase; acyltransferase; HET: NHM; | 97.09 | |
| 1iyk_A | 392 | Myristoyl-COA:protein N-myristoyltransferase; HET: | 97.07 | |
| 3gkr_A | 336 | FEMX; FEMX, peptidoglycan, hexapeptide, transferas | 97.01 | |
| 1rxt_A | 496 | Myristoyl-, glycylpeptide N-tetradecanoyltransfera | 96.58 | |
| 3gkr_A | 336 | FEMX; FEMX, peptidoglycan, hexapeptide, transferas | 96.47 | |
| 3s6k_A | 467 | Acetylglutamate kinase; synthase, transferase; 2.8 | 96.34 | |
| 1lrz_A | 426 | FEMA, factor essential for expression of methicill | 96.32 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 96.17 | |
| 1iic_A | 422 | Peptide N-myristoyltransferase; HET: MYA; 2.20A {S | 96.15 | |
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 96.13 | |
| 2ou2_A | 280 | Histone acetyltransferase htatip; structural genom | 96.12 | |
| 2ozu_A | 284 | Histone acetyltransferase MYST3; structural genomi | 96.12 | |
| 3to7_A | 276 | Histone acetyltransferase ESA1; MYST family; HET: | 96.02 | |
| 2pq8_A | 278 | Probable histone acetyltransferase MYST1; MOF, str | 95.86 | |
| 1iyk_A | 392 | Myristoyl-COA:protein N-myristoyltransferase; HET: | 95.84 | |
| 2wuu_A | 421 | N-myristoyltransferase; acyltransferase; HET: NHM; | 95.57 | |
| 4ab7_A | 464 | Protein Arg5,6, mitochondrial; transferase, argini | 95.31 | |
| 1lrz_A | 426 | FEMA, factor essential for expression of methicill | 95.24 | |
| 3fxt_A | 113 | Nucleoside diphosphate-linked moiety X motif 6; nu | 95.09 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 92.54 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 91.58 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 88.87 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 86.13 | |
| 1rxt_A | 496 | Myristoyl-, glycylpeptide N-tetradecanoyltransfera | 83.27 |
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
Probab=99.97 E-value=4.6e-29 Score=163.84 Aligned_cols=148 Identities=33% Similarity=0.434 Sum_probs=123.5
Q ss_pred CeEEeeCCcccHHHHHhcccCccccccChHHHHHHHhcCCcEEEEEEcCCCcEEEEEEeEeeCCC--------CeeEEEE
Q psy13682 1 MTTLRAFTCDDMFKFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPTGEIMGYIMGKAEGHG--------DKWHGHV 72 (175)
Q Consensus 1 m~~ir~~~~~d~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~ivG~~~~~~~~~~--------~~~~~~i 72 (175)
|++||+++++|++.+.++....+...++...+...+...+..++++.. ++++||++.+...... ....+++
T Consensus 12 ~~~iR~~~~~D~~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~va~~-~~~ivG~~~~~~~~~~~~~~~~~~~~~~~~i 90 (168)
T 2x7b_A 12 DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIV-DNSVVGYIMPRIEWGFSNIKQLPSLVRKGHV 90 (168)
T ss_dssp CCEEEECCGGGHHHHHHHHHHHCSCCCCHHHHHHHHHHHGGGCEEEEE-TTEEEEEEEEEEEEEECSSCSSCCEEEEEEE
T ss_pred cEEEEeCCHHHHHHHHHHHHHHCCCCccHHHHHHHHhcCCceEEEEEE-CCeEEEEEEEEEeccccccccccCCCcEEEE
Confidence 478999999999999999877777777776666666543445667776 8999999988764321 2235778
Q ss_pred EEEEECcchhccChHHHHHHHHHHHHHHc-CccEEEEEEEecCHHHHHHHHhcCcEEEEEEEeeccCCCCcceeEEEecc
Q psy13682 73 TALTVAPDYRRLGIAAELMSWLEDISEKK-RAYFVDLFVRVSNTVAITMYKRLGYIVYRTVLEYYSGSPDEDAYDMRKAL 151 (175)
Q Consensus 73 ~~~~V~~~~rg~Gig~~ll~~~~~~~~~~-g~~~i~~~~~~~n~~~~~~y~k~Gf~~~~~~~~~~~~~~~~~~~~m~~~l 151 (175)
..++|+|+|||+|+|++|++.+++++++. |+..+.+.|...|.+|++||+|+||+..+....++.++ .+.++|.+.|
T Consensus 91 ~~l~V~p~~rg~GiG~~Ll~~~~~~a~~~~g~~~i~l~v~~~N~~A~~~Yek~GF~~~~~~~~~~~~g--~~~~~m~~~l 168 (168)
T 2x7b_A 91 VSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADG--EDAYLMARPL 168 (168)
T ss_dssp EEEEECGGGTTSSHHHHHHHHHHHHHHHTTCCSEEEEEEETTCHHHHHHHHHTTCEEEEEETTCSTTS--CCEEEEEEC-
T ss_pred EEEEECHHHhccCHHHHHHHHHHHHHHHhcCeeEEEEEEEeCCHHHHHHHHHCCCEEEEEeecccCCC--CcEEEEEecC
Confidence 89999999999999999999999999998 99999999999999999999999999999988877665 7899998864
|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A | Back alignment and structure |
|---|
| >2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 | Back alignment and structure |
|---|
| >3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* | Back alignment and structure |
|---|
| >1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* | Back alignment and structure |
|---|
| >1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* | Back alignment and structure |
|---|
| >4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* | Back alignment and structure |
|---|
| >2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
| >4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A | Back alignment and structure |
|---|
| >3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A | Back alignment and structure |
|---|
| >1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 | Back alignment and structure |
|---|
| >3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A | Back alignment and structure |
|---|
| >3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1lrz_A FEMA, factor essential for expression of methicillin resistance; peptidoglycan, X-RAY crystallography, multiple anomalous dispersion; 2.10A {Staphylococcus aureus} SCOP: a.2.7.4 d.108.1.4 d.108.1.4 | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A | Back alignment and structure |
|---|
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* | Back alignment and structure |
|---|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* | Back alignment and structure |
|---|
| >4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* | Back alignment and structure |
|---|
| >1lrz_A FEMA, factor essential for expression of methicillin resistance; peptidoglycan, X-RAY crystallography, multiple anomalous dispersion; 2.10A {Staphylococcus aureus} SCOP: a.2.7.4 d.108.1.4 d.108.1.4 | Back alignment and structure |
|---|
| >3fxt_A Nucleoside diphosphate-linked moiety X motif 6; nudix, NUDT6, GFG, FGF2AS, antisense basic fibroblast growth FGF-2 regulation, hydrolase; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 175 | ||||
| d1sqha_ | 297 | d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr | 6e-15 | |
| d1tiqa_ | 173 | d.108.1.1 (A:) Protease synthase and sporulation n | 3e-12 | |
| d1vkca_ | 149 | d.108.1.1 (A:) Putative acetyltransferase PF0028 { | 3e-11 | |
| d1s3za_ | 147 | d.108.1.1 (A:) Aminoglycoside N-acetyltransferase | 9e-10 | |
| d1z4ea1 | 150 | d.108.1.1 (A:4-153) Transcriptional regulator BH19 | 2e-09 | |
| d2cy2a1 | 174 | d.108.1.1 (A:1-174) Probable acetyltransferase TTH | 3e-09 | |
| d1p0ha_ | 308 | d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacter | 1e-08 | |
| d1u6ma_ | 189 | d.108.1.1 (A:) Putative acetyltransferase EF0945 { | 1e-08 | |
| d1bo4a_ | 137 | d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferas | 3e-08 | |
| d1cjwa_ | 166 | d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep | 5e-08 | |
| d1ufha_ | 155 | d.108.1.1 (A:) Putative acetyltransferase YycN {Ba | 9e-08 | |
| d1n71a_ | 180 | d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera | 2e-07 | |
| d1y9ka1 | 152 | d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillu | 2e-07 | |
| d1y9wa1 | 140 | d.108.1.1 (A:1-140) Probable acetyltransferase BC2 | 4e-07 | |
| d1m4ia_ | 181 | d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransfera | 1e-06 | |
| d2fe7a1 | 156 | d.108.1.1 (A:3-158) Probable N-acetyltransferase P | 1e-06 | |
| d1yvka1 | 152 | d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu | 2e-06 | |
| d1yx0a1 | 151 | d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bac | 3e-06 | |
| d2gana1 | 182 | d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P | 4e-06 | |
| d1ghea_ | 170 | d.108.1.1 (A:) Tabtoxin resistance protein {Pseudo | 1e-05 | |
| d2b5ga1 | 167 | d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {H | 1e-05 | |
| d2beia1 | 167 | d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {H | 3e-05 | |
| d1wwza1 | 157 | d.108.1.1 (A:1-157) Hypothetical protein PH1933 {P | 4e-05 | |
| d1i12a_ | 157 | d.108.1.1 (A:) Glucosamine-phosphate N-acetyltrans | 7e-05 | |
| d2jdca1 | 145 | d.108.1.1 (A:2-146) Probable acetyltransferase Yit | 7e-05 | |
| d1y7ra1 | 133 | d.108.1.1 (A:1-133) Hypothetical protein SA2161 {S | 3e-04 | |
| d1mk4a_ | 157 | d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus | 3e-04 | |
| d2atra1 | 137 | d.108.1.1 (A:1-137) Probable acetyltransferase SP0 | 6e-04 | |
| d2fiaa1 | 157 | d.108.1.1 (A:1-157) Probable acetyltransferase EF1 | 6e-04 | |
| d2hv2a2 | 285 | d.108.1.10 (A:2-286) Hypothetical protein EF1021 { | 0.002 | |
| d1q2ya_ | 140 | d.108.1.1 (A:) Probable acetyltransferase YjcF {Ba | 0.002 | |
| d1yk3a1 | 198 | d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/ | 0.003 | |
| d2ge3a1 | 164 | d.108.1.1 (A:6-169) Probable acetyltransferase Atu | 0.004 | |
| d2i00a2 | 291 | d.108.1.10 (A:10-300) Putative acetyltransferase E | 0.004 |
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: Hypothetical protein cg14615-pa domain: Hypothetical protein cg14615-pa species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Score = 68.5 bits (167), Expect = 6e-15
Identities = 22/111 (19%), Positives = 43/111 (38%), Gaps = 8/111 (7%)
Query: 31 FYMQYLAHWPEYFQVAESPTGEIMGYIMGKAEGHGDKWHGHVTALTVAPDYRRLGIAAEL 90
Y+Q L + + + S TGE++ +I D + L V P R G+ L
Sbjct: 194 TYLQALVRFNKSLGICRSDTGELIAWIF-----QND--FSGLGMLQVLPKAERRGLGGLL 246
Query: 91 MSWLEDISEKKRAYFVDLFVRVSNTVAITMYKRLGYIVYRTVLEYYSGSPD 141
+ + + + ++ +N + + KR+GY E+ P+
Sbjct: 247 AAAMSREIARGEEITLTAWIVATNWRSEALLKRIGYQKDLVN-EWIKLVPN 296
|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Length = 173 | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Length = 149 | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Length = 147 | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Length = 150 | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Length = 174 | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 308 | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Length = 189 | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Length = 137 | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Length = 166 | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Length = 155 | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180 | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Length = 152 | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Length = 140 | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Length = 156 | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Length = 152 | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Length = 151 | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182 | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Length = 170 | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Length = 157 | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 157 | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Length = 145 | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Length = 133 | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Length = 157 | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Length = 137 | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Length = 157 | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Length = 285 | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Length = 140 | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 198 | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Length = 164 | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Length = 291 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 99.96 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 99.95 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 99.95 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 99.95 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 99.95 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 99.95 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 99.94 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 99.94 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 99.94 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 99.94 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 99.94 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 99.93 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 99.93 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 99.93 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 99.93 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 99.93 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 99.93 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 99.92 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 99.92 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 99.91 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 99.9 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 99.9 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 99.9 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 99.9 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 99.9 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 99.89 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 99.89 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.89 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 99.89 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 99.88 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 99.88 | |
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 99.88 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 99.88 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 99.88 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 99.88 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 99.87 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 99.87 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 99.87 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 99.87 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 99.87 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 99.86 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 99.86 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 99.84 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 99.82 | |
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.82 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 99.81 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 99.79 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 99.79 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 99.77 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 99.75 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 99.74 | |
| d2fsra1 | 164 | Probable acetyltranferase Atu2435 {Agrobacterium t | 99.73 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 99.72 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 99.71 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 99.7 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 99.52 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 99.16 | |
| d1ro5a_ | 197 | Autoinducer synthesis protein LasI {Pseudomonas ae | 98.9 | |
| d1kzfa_ | 210 | Acyl-homoserinelactone synthase EsaI {Pantoea stew | 98.72 | |
| d1ylea1 | 338 | Arginine N-succinyltransferase, alpha chain, AstA | 98.66 | |
| d2d4pa1 | 130 | Hypothetical protein TTHA1254 {Thermus thermophilu | 98.34 | |
| d1xmta_ | 95 | Hypothetical protein AT1g77540 {Thale cress (Arabi | 98.27 | |
| d1lrza3 | 182 | Methicillin resistance protein FemA {Staphylococcu | 98.15 | |
| d1lrza2 | 165 | Methicillin resistance protein FemA {Staphylococcu | 98.04 | |
| d1iyka1 | 165 | N-myristoyl transferase, NMT {Yeast (Candida albic | 97.79 | |
| d1rxta1 | 141 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 97.78 | |
| d1iica1 | 185 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 97.7 | |
| d1boba_ | 315 | Histone acetyltransferase HAT1 {Baker's yeast (Sac | 97.59 | |
| d1ne9a2 | 171 | Peptidyltransferase FemX {Weissella viridescens [T | 96.81 | |
| d1ne9a1 | 164 | Peptidyltransferase FemX {Weissella viridescens [T | 96.7 | |
| d1iyka2 | 227 | N-myristoyl transferase, NMT {Yeast (Candida albic | 96.66 | |
| d1iica2 | 237 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 96.44 | |
| d2giva1 | 271 | Probable histone acetyltransferase MYST1 {Human (H | 96.41 | |
| d2ozua1 | 270 | Histone acetyltransferase MYST3 {Human (Homo sapie | 96.38 | |
| d1fy7a_ | 273 | Histone acetyltransferase ESA1 {Baker's yeast (Sac | 96.17 | |
| d1rxta2 | 201 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 92.17 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 91.97 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 91.12 | |
| d2hqya1 | 164 | Hypothetical protein BT3689 {Bacteroides thetaiota | 86.58 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 82.28 | |
| d1xqaa_ | 113 | Hypothetical protein BC3580 {Bacillus cereus [TaxI | 81.7 |
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Protease synthase and sporulation negative regulatory protein PaiA species: Bacillus subtilis [TaxId: 1423]
Probab=99.96 E-value=1.5e-27 Score=155.89 Aligned_cols=150 Identities=15% Similarity=0.230 Sum_probs=120.0
Q ss_pred eEEeeCCcccHHHHHhcccCcccc----ccC-------------hHHHHHHHhcCCcEEEEEEcCCCcEEEEEEeEeeCC
Q psy13682 2 TTLRAFTCDDMFKFNNVNLDPLTE----TYG-------------LSFYMQYLAHWPEYFQVAESPTGEIMGYIMGKAEGH 64 (175)
Q Consensus 2 ~~ir~~~~~d~~~l~~l~~~~~~~----~~~-------------~~~~~~~~~~~~~~~~v~~~~~~~ivG~~~~~~~~~ 64 (175)
|+||+++++|++.|.++..+.|.+ .++ .+.+...+.+....++++.. +|++||++.+.....
T Consensus 2 i~ir~at~~D~~~l~~l~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~l~~~~~~~~v~~~-~~~ivG~~~~~~~~~ 80 (173)
T d1tiqa_ 2 VKMKKCSREDLQTLQQLSIETFNDTFKEQNSPENMKAYLESAFNTEQLEKELSNMSSQFFFIYF-DHEIAGYVKVNIDDA 80 (173)
T ss_dssp EEEEECCGGGHHHHHHHHHHHHHHHHSTTSCHHHHHHHHHHHSSHHHHHHHHHCTTEEEEEEEE-TTEEEEEEEEEEGGG
T ss_pred EEEEECCHHHHHHHHHHHHHHHHHHhcccCCHHHHHHHHHhcCCHHHHHHHHhCCCcEEEEEEE-CCEecceEEEEecCc
Confidence 789999999999999985554322 222 23344445555566777777 899999999876432
Q ss_pred C----CeeEEEEEEEEECcchhccChHHHHHHHHHHHHHHcCccEEEEEEEecCHHHHHHHHhcCcEEEEEEEeeccCCC
Q psy13682 65 G----DKWHGHVTALTVAPDYRRLGIAAELMSWLEDISEKKRAYFVDLFVRVSNTVAITMYKRLGYIVYRTVLEYYSGSP 140 (175)
Q Consensus 65 ~----~~~~~~i~~~~V~~~~rg~Gig~~ll~~~~~~~~~~g~~~i~~~~~~~n~~~~~~y~k~Gf~~~~~~~~~~~~~~ 140 (175)
. ....++|..++|+|++||+|+|+.|++++++++++.|+..+.+.|...|.+|++||+|+||+..+....++++.
T Consensus 81 ~~~~~~~~~~~i~~i~v~~~~rgkGig~~ll~~~~~~~~~~g~~~i~l~v~~~N~~a~~fY~k~GF~~~g~~~~~~~~~- 159 (173)
T d1tiqa_ 81 QSEEMGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIALERNKKNIWLGVWEKNENAIAFYKKMGFVQTGAHSFYMGDE- 159 (173)
T ss_dssp SSSCCCTTEEEEEEEEECGGGCSSSHHHHHHHHHHHHHHHTTCSEEEEEEETTCHHHHHHHHHTTCEEEEEEEEEETTE-
T ss_pred cccccCCCeEEEEEEEECHHHcCCCCCcchhHhhhhhhhhhhcchhhccccccCHHHHHHHHHCCCEEeeEEEeecCCC-
Confidence 1 23367899999999999999999999999999999999999999999999999999999999999866555544
Q ss_pred CcceeEEEecccc
Q psy13682 141 DEDAYDMRKALSR 153 (175)
Q Consensus 141 ~~~~~~m~~~l~~ 153 (175)
..+.++|.|.|..
T Consensus 160 ~~~~~im~k~L~~ 172 (173)
T d1tiqa_ 160 EQTDLIMAKTLIL 172 (173)
T ss_dssp EEEEEEEEEECCC
T ss_pred CcEEEEEEeECCC
Confidence 3778899998853
|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} | Back information, alignment and structure |
|---|
| >d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2d4pa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1lrza2 d.108.1.4 (A:1-165) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} | Back information, alignment and structure |
|---|
| >d1ne9a1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} | Back information, alignment and structure |
|---|
| >d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1iica2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rxta2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d2hqya1 d.108.1.4 (A:135-298) Hypothetical protein BT3689 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|