Diaphorina citri psyllid: psy13695


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MADPRIKTLKIKTGVLKRIAKEKTTYIKEVGIEQERYEKFKSEGSDEFKLKKQLEVIQESQMMIPECQRRMVRAYEELKSILDSEQDLKDTEDYTIALQILDDAQKEIEKA
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcc
***PRIKTLKIKTGVLKRIAKEKTTYIKEVGIE*********EGS*EFKLKKQLEVIQESQMMIPECQRRMVRAYEELKSILD********EDYTIALQILDDAQK*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADPRIKTLKIKTGVLKRIAKEKTTYIKEVGIEQERYEKFKSEGSDEFKLKKQLEVIQESQMMIPECQRRMVRAYEELKSILDSEQDLKDTEDYTIALQILDDAQKEIEKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tubulin-specific chaperone A Tubulin-folding protein; involved in the early step of the tubulin folding pathway.very confidentQ6PEC1
Tubulin-specific chaperone A Tubulin-folding protein; involved in the early step of the tubulin folding pathway.confidentP48428
Tubulin-specific chaperone A Tubulin-folding protein; involved in the early step of the tubulin folding pathway.confidentO75347

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048487 [MF]beta-tubulin bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0007021 [BP]tubulin complex assemblyprobableGO:0072668, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0043623, GO:0071840
GO:0007023 [BP]post-chaperonin tubulin folding pathwayprobableGO:0044267, GO:0072668, GO:0006457, GO:0044260, GO:0070271, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0044085, GO:0008150, GO:0008152, GO:0044238, GO:0071840
GO:0051084 [BP]'de novo' posttranslational protein foldingprobableGO:0044267, GO:0009987, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0006458, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0051087 [MF]chaperone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0000910 [BP]cytokinesisprobableGO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H7C, chain A
Confidence level:very confident
Coverage over the Query: 4-106
View the alignment between query and template
View the model in PyMOL