Diaphorina citri psyllid: psy13700

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------

MDESSKKTLSSIPLLKTKAGPRDKDLWPKRLKEEYVALIEYVKNNKAADNDWFRLESNKEGTKWFGSCWFFYNQLKYEFQIEFDIPITFPTTAPELALPELDGKTAKMYRGGKICLSDHFKPLWARNVPKFGIAHAMALGLGPWLAVEIPALVDAGIIKYQEKTES

ccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEccccccccEEEEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccCEECcccccHHHHcccccHHHHHHHHHccccEEHHHHHHHHHHccccccccccc

*****KK*LSSIPLLKTKAGPRDKDLWPKRLKEEYVALIEYVKNNKAADNDWFRLESNKEGTKWFGSCWFFYNQLKYEFQIEFDIPITFPTTAPELALPELDGKTAKMYRGGKICLSDHFKPLWARNVPKFGIAHAMALGLGPWLAVEIPALVDAGIIKY******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDESSKKTLSSIPLLKTKAGPRDKDLWPKRLKEEYVALIEYVKNNKAADNDWFRLESNKEGTKWFGSCWFFYNQLKYEFQIEFDIPITFPTTAPELALPELDGKTAKMYRGGKICLSDHFKPLWARNVPKFGIAHAMALGLGPWLAVEIPALVDAGIIKYQEKTES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ubiquitin-fold modifier-conjugating enzyme 1	E2-like enzyme which forms an intermediate with UFM1 via a thioester linkage.	very confident	Q9CR09
Ubiquitin-fold modifier-conjugating enzyme 1	E2-like enzyme which forms an intermediate with UFM1 via a thioester linkage.	very confident	C3ZDX5
Ubiquitin-fold modifier-conjugating enzyme 1	E2-like enzyme which forms an intermediate with UFM1 via a thioester linkage.	very confident	Q03598

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0071569 [BP]	protein ufmylation	confident	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0071568 [MF]	UFM1 conjugating enzyme activity	confident	GO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0055120 [CC]	striated muscle dense body	confident	GO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0046331 [BP]	lateral inhibition	confident	GO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0005515 [MF]	protein binding	confident	GO:0003674, GO:0005488
GO:0009407 [BP]	toxin catabolic process	probable	GO:0044710, GO:0009987, GO:0019748, GO:0044237, GO:0044248, GO:0008150, GO:0009404, GO:0008152, GO:0009056
GO:0009507 [CC]	chloroplast	probable	GO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048193 [BP]	Golgi vesicle transport	probable	GO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0006944 [BP]	cellular membrane fusion	probable	GO:0016044, GO:0009987, GO:0016043, GO:0061025, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z6O, chain A
Confidence level:very confident
Coverage over the Query: 1-165
View the alignment between query and template
View the model in PyMOL