Diaphorina citri psyllid: psy13720


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------
LYYNCVSYEGEQYKLKSCVYVNPDCFKFKSKPQSAVQNNKRPVEDEELYPEAYRKLSDYMKGSNAYTPAPFGIGYIVAIFKKKGKKNVSASDVFLTVKKFYRPENTHRSVEFTYQLDLNKLYWSDEEEQVSLSDVQGKCFVVCEDNLQISTDRWSSRGPHRFYFNEAYNSKTEEFTNLPTEALFLGSVSKGKGKGKNQTNKPEEKDEITEWPSIARPLRCLEVFAGAGGLSRGLDKSGVARSTWAIEFDSAAATAFKMNNPGCTVFVDDCNKILQRVIDNEVCDDKKQKLPRKGEVEMLCGGPPCQGFSGMNRFNQRQYSAFKNSLIVSYLSYCDYYRPRFFLLENVRNFVAFKNSMVLKMTMRCLTQIGYQCTFGTLQAGHFGVSQTRRRAIVLAAAPGEVLPKYPEPWTVFSPRTSQLNVTISKKTYVSTCKWTQSAPYRTITVRDVMSDLPEIQNGCKMEELPYKENALSHFQREKVWKCYSKI
cCEEEEEEccEEEEEccEEEEccccccccccccccccccccccccccccccEEEEccccccccccccccccEEEEEEEEEEcccccccccccEEEEEEEEEccccccccccccccccccEEEcccccEEEccccEEEEEEEEECccccccccccccccccEEEEEEEcccccccccccccHHcccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHccccEEEEEEEccHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHcccccccccccccEEEEECccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHcccEEEEEEEECccccccccccEEEEEECcccccccccccccccccccccccEEEccccccccccccccccccccccHHHHHcccccccccccccccccccccccHHHHHHHHcccccc
LYYNCVSYEGEQYKLKSCVYVNPDCFKF******************ELYPEAYRKLSDYMKGSNAYTPAPFGIGYIVAIFKKKGKKNVSASDVFLTVKKFYRPENTHRSVEFTYQLDLNKLYWSDEEEQVSLSDVQGKCFVVCEDNLQISTDRWSSRGPHRFYFNEAYNSKTEEFTNLPT*A********************************ARPLRCLEVFAGAGGLSRGLDKSGVARSTWAIEFDSAAATAFKMNNPGCTVFVDDCNKILQRVIDNEVCDDKKQKLPRKGEVEMLCGGPPCQGFSGMNRFNQRQYSAFKNSLIVSYLSYCDYYRPRFFLLENVRNFVAFKNSMVLKMTMRCLTQIGYQCTFGTLQAGHFGVSQTRRRAIVLAAAPGEVLPKYPEPWTVFSPRTSQLNVTISKKTYVSTCKWTQSAPYRTITVRDVMSDLPEIQNGCKMEELPYKENALSHFQREKVWKC****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LYYNCVSYEGEQYKLKSCVYVNPDCFKFKSKPQSAVQNNKRPVEDEELYPEAYRKLSDYMKGSNAYTPAPFGIGYIVAIFKKKGKKNVSASDVFLTVKKFYRPENTHRSVEFTYQLDLNKLYWSDEEEQVSLSDVQGKCFVVCEDNLQISTDRWSSRGPHRFYFNEAYNSKTEEFTNLPTEALFLGSVSKGKGKGKNQTNKPEEKDEITEWPSIARPLRCLEVFAGAGGLSRGLDKSGVARSTWAIEFDSAAATAFKMNNPGCTVFVDDCNKILQRVIDNEVCDDKKQKLPRKGEVEMLCGGPPCQGFSGMNRFNQRQYSAFKNSLIVSYLSYCDYYRPRFFLLENVRNFVAFKNSMVLKMTMRCLTQIGYQCTFGTLQAGHFGVSQTRRRAIVLAAAPGEVLPKYPEPWTVFSPRTSQLNVTISKKTYVSTCKWTQSAPYRTITVRDVMSDLPEIQNGCKMEELPYKENALSHFQREKVWKCYSKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA (cytosine-5)-methyltransferase 1 Methylates CpG residues. Preferentially methylates hemimethylated DNA. Associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance. Associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones. Mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.confidentP13864
DNA (cytosine-5)-methyltransferase 1 Methylates CpG residues. Preferentially methylates hemimethylated DNA. Associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance. Associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones. Mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.confidentQ24K09
DNA (cytosine-5)-methyltransferase 1 Methylates CpG residues. Preferentially methylates hemimethylated DNA. Associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance. Associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones. Mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.confidentP26358

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0051718 [MF]DNA (cytosine-5-)-methyltransferase activity, acting on CpG substratesprobableGO:0003824, GO:0008757, GO:0003886, GO:0016740, GO:0016741, GO:0003674, GO:0008168, GO:0009008
GO:0046500 [BP]S-adenosylmethionine metabolic processprobableGO:0006520, GO:0006732, GO:0019752, GO:0034641, GO:0006807, GO:0044281, GO:0072521, GO:1901360, GO:0006139, GO:0044710, GO:0051186, GO:0042278, GO:0071704, GO:0009987, GO:0006725, GO:0008150, GO:0009116, GO:0008152, GO:0043436, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0006575, GO:0006082, GO:1901135, GO:0044237, GO:1901657, GO:0006790
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0016458 [BP]gene silencingprobableGO:0010605, GO:0019222, GO:0060255, GO:0009987, GO:0050789, GO:0008150, GO:0010629, GO:0065007, GO:0044763, GO:0048519, GO:0009892, GO:0010468, GO:0044699
GO:0046499 [BP]S-adenosylmethioninamine metabolic processprobableGO:0034641, GO:0006807, GO:0044281, GO:0072521, GO:1901360, GO:0006139, GO:0044710, GO:0042278, GO:0071704, GO:0009987, GO:0006725, GO:0008150, GO:0009116, GO:0008152, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:1901657, GO:0006790
GO:0046498 [BP]S-adenosylhomocysteine metabolic processprobableGO:0042278, GO:0019752, GO:0034641, GO:0006807, GO:0044281, GO:0072521, GO:1901360, GO:0006139, GO:0044710, GO:0006520, GO:0071704, GO:1901605, GO:0009987, GO:0006725, GO:0008150, GO:0009116, GO:0008152, GO:0043436, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0006575, GO:0006082, GO:1901135, GO:0044237, GO:1901657, GO:0006790
GO:0005657 [CC]replication forkprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0010424 [BP]DNA methylation on cytosine within a CG sequenceprobableGO:0019222, GO:0032776, GO:0090304, GO:0034641, GO:0006807, GO:0050789, GO:1901360, GO:0006306, GO:0006305, GO:0006304, GO:0044260, GO:0040029, GO:0071704, GO:0065007, GO:0032259, GO:0010468, GO:0006139, GO:0060255, GO:0009987, GO:0006725, GO:0043412, GO:0044728, GO:0043414, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0005721 [CC]centromeric heterochromatinprobableGO:0044446, GO:0005622, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0000792, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0090116 [BP]C-5 methylation of cytosineprobableGO:0019222, GO:0032776, GO:0090304, GO:0034641, GO:0006807, GO:0050789, GO:1901360, GO:0006306, GO:0006305, GO:0006304, GO:0044260, GO:0040029, GO:0071704, GO:0065007, GO:0032259, GO:0010468, GO:0006139, GO:0060255, GO:0009987, GO:0006725, GO:0043412, GO:0044728, GO:0043414, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0010216 [BP]maintenance of DNA methylationprobableGO:0019222, GO:0090304, GO:0034641, GO:0006807, GO:0050789, GO:1901360, GO:0006306, GO:0006305, GO:0006304, GO:0044260, GO:0040029, GO:0071704, GO:0065007, GO:0032259, GO:0010468, GO:0006139, GO:0060255, GO:0009987, GO:0006725, GO:0043412, GO:0044728, GO:0043414, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0071230 [BP]cellular response to amino acid stimulusprobableGO:1901700, GO:0043200, GO:0051716, GO:0009719, GO:1901701, GO:1901698, GO:0071417, GO:1901699, GO:0008150, GO:0044699, GO:0071229, GO:0071495, GO:0071310, GO:0044763, GO:0001101, GO:0070887, GO:0050896, GO:0042221, GO:0009987, GO:0010243, GO:0010033
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0051571 [BP]positive regulation of histone H3-K4 methylationprobableGO:0033044, GO:0009893, GO:0019222, GO:0033043, GO:0031325, GO:0031323, GO:0051128, GO:0051569, GO:0031056, GO:0031058, GO:0050789, GO:0080090, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0051130, GO:0060255, GO:0050794, GO:0031060, GO:0031062, GO:0032268, GO:0031401, GO:0010638, GO:0008150, GO:2001252, GO:0048522
GO:0051573 [BP]negative regulation of histone H3-K9 methylationprobableGO:0033044, GO:0009892, GO:0080090, GO:0019222, GO:0033043, GO:0031324, GO:0031323, GO:0051129, GO:0051128, GO:0031057, GO:0031056, GO:0050789, GO:0044699, GO:0051248, GO:0010605, GO:0051246, GO:0008150, GO:0065007, GO:0031399, GO:0048519, GO:0060255, GO:0009987, GO:0050794, GO:0031060, GO:0031061, GO:0051570, GO:0032269, GO:0032268, GO:0031400, GO:0010639, GO:0044763, GO:0048523, GO:2001251
GO:0045322 [MF]unmethylated CpG bindingprobableGO:0043565, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SWR, chain A
Confidence level:very confident
Coverage over the Query: 1-185,207-485
View the alignment between query and template
View the model in PyMOL