Psyllid ID: psy13720
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 487 | 2.2.26 [Sep-21-2011] | |||||||
| P13864 | 1620 | DNA (cytosine-5)-methyltr | yes | N/A | 0.991 | 0.298 | 0.545 | 1e-147 | |
| Q24K09 | 1611 | DNA (cytosine-5)-methyltr | yes | N/A | 0.991 | 0.299 | 0.526 | 1e-143 | |
| Q92072 | 1537 | DNA (cytosine-5)-methyltr | yes | N/A | 0.971 | 0.307 | 0.545 | 1e-142 | |
| Q9Z330 | 1622 | DNA (cytosine-5)-methyltr | yes | N/A | 0.956 | 0.287 | 0.543 | 1e-141 | |
| P26358 | 1616 | DNA (cytosine-5)-methyltr | yes | N/A | 0.989 | 0.298 | 0.526 | 1e-141 | |
| Q27746 | 1612 | DNA (cytosine-5)-methyltr | N/A | N/A | 0.965 | 0.291 | 0.542 | 1e-139 | |
| B1Q3J6 | 1529 | DNA (cytosine-5)-methyltr | yes | N/A | 0.930 | 0.296 | 0.354 | 4e-79 | |
| P34881 | 1534 | DNA (cytosine-5)-methyltr | yes | N/A | 0.895 | 0.284 | 0.362 | 6e-77 | |
| Q7Y1I7 | 1527 | DNA (cytosine-5)-methyltr | yes | N/A | 0.813 | 0.259 | 0.357 | 1e-76 | |
| Q9AXT8 | 912 | DNA (cytosine-5)-methyltr | N/A | N/A | 0.390 | 0.208 | 0.319 | 3e-25 |
| >sp|P13864|DNMT1_MOUSE DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus GN=Dnmt1 PE=1 SV=5 | Back alignment and function desciption |
|---|
Score = 522 bits (1344), Expect = e-147, Method: Compositional matrix adjust.
Identities = 268/491 (54%), Positives = 336/491 (68%), Gaps = 8/491 (1%)
Query: 1 LYYNCVSYEGEQYKLKSCVYVNPDCFKFKSKPQSAVQNNKRPVEDEELYPEAYRKLSDYM 60
+Y + ++ G Y+L VY+ P+ F F K S V+ K+ +E LYPE YRK SDY+
Sbjct: 925 VYCSSITKNGVVYRLGDSVYLPPEAFTFNIKVASPVKRPKKDPVNETLYPEHYRKYSDYI 984
Query: 61 KGSNAYTPAPFGIGYIVAIFKKKGKKNVSASDVFLTVKKFYRPENTHRSVEFTYQLDLNK 120
KGSN P P+ IG I I K K V+ +D+ L + KFYRPENTHRS +Y D+N
Sbjct: 985 KGSNLDAPEPYRIGRIKEIHCGKKKGKVNEADIKLRLYKFYRPENTHRSYNGSYHTDINM 1044
Query: 121 LYWSDEEEQVSLSDVQGKCFVVCEDNLQISTDRWSSRGPHRFYFNEAYNSKTEEFTNLPT 180
LYWSDEE V+ SDVQG+C V ++L S +S GP RFYF EAYNSKT+ F + P
Sbjct: 1045 LYWSDEEAVVNFSDVQGRCTVEYGEDLLESIQDYSQGGPDRFYFLEAYNSKTKNFEDPPN 1104
Query: 181 EA----LFLGSVSKGKGKGKNQTNKPEEKDEITEWPSIARPLRCLEVFAGAGGLSRGLDK 236
A KGKGKGK+Q ++P+E + + P LR L+VF+G GGLS G +
Sbjct: 1105 HARSPGNKGKGKGKGKGKGKHQVSEPKEPEAAIKLPK----LRTLDVFSGCGGLSEGFHQ 1160
Query: 237 SGVARSTWAIEFDSAAATAFKMNNPGCTVFVDDCNKILQRVIDNEVCDDKKQKLPRKGEV 296
+G++ + WAIE AA AF++NNPG TVF +DCN +L+ V+ EV + Q+LP+KG+V
Sbjct: 1161 AGISETLWAIEMWDPAAQAFRLNNPGTTVFTEDCNVLLKLVMAGEVTNSLGQRLPQKGDV 1220
Query: 297 EMLCGGPPCQGFSGMNRFNQRQYSAFKNSLIVSYLSYCDYYRPRFFLLENVRNFVAFKNS 356
EMLCGGPPCQGFSGMNRFN R YS FKNSL+VS+LSYCDYYRPRFFLLENVRNFV+++ S
Sbjct: 1221 EMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSYRRS 1280
Query: 357 MVLKMTMRCLTQIGYQCTFGTLQAGHFGVSQTRRRAIVLAAAPGEVLPKYPEPWTVFSPR 416
MVLK+T+RCL ++GYQCTFG LQAG +GV+QTRRRAI+LAAAPGE LP +PEP VF+PR
Sbjct: 1281 MVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPR 1340
Query: 417 TSQLNVTISKKTYVSTCKWTQSAPYRTITVRDVMSDLPEIQNGCKMEELPYKENALSHFQ 476
QL+V + K +VS S P+RTITVRD MSDLPEIQNG E+PY LS FQ
Sbjct: 1341 ACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEIQNGASNSEIPYNGEPLSWFQ 1400
Query: 477 REKVWKCYSKI 487
R+ Y I
Sbjct: 1401 RQLRGSHYQPI 1411
|
Methylates CpG residues. Preferentially methylates hemimethylated DNA. Associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance. Associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones. Mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. Mus musculus (taxid: 10090) EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 7 |
| >sp|Q24K09|DNMT1_BOVIN DNA (cytosine-5)-methyltransferase 1 OS=Bos taurus GN=DNMT1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q92072|DNMT1_CHICK DNA (cytosine-5)-methyltransferase 1 OS=Gallus gallus GN=DNMT1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Z330|DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus GN=Dnmt1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P26358|DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens GN=DNMT1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q27746|DNMT1_PARLI DNA (cytosine-5)-methyltransferase PliMCI OS=Paracentrotus lividus GN=DNMT PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|B1Q3J6|DNM1B_ORYSJ DNA (cytosine-5)-methyltransferase 1B OS=Oryza sativa subsp. japonica GN=MET1B PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P34881|DNMT1_ARATH DNA (cytosine-5)-methyltransferase 1 OS=Arabidopsis thaliana GN=DMT1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q7Y1I7|DNM1A_ORYSJ DNA (cytosine-5)-methyltransferase 1A OS=Oryza sativa subsp. japonica GN=MET1A PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9AXT8|CMT1_MAIZE DNA (cytosine-5)-methyltransferase 1 OS=Zea mays GN=MET2A PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 487 | ||||||
| 350422372 | 1368 | PREDICTED: DNA (cytosine-5)-methyltransf | 1.0 | 0.355 | 0.532 | 1e-155 | |
| 383852983 | 1698 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.997 | 0.286 | 0.531 | 1e-151 | |
| 283549178 | 1366 | DNA methyltransferase 1a [Apis mellifera | 0.997 | 0.355 | 0.529 | 1e-150 | |
| 110765384 | 1427 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.977 | 0.333 | 0.537 | 1e-150 | |
| 340728437 | 635 | PREDICTED: LOW QUALITY PROTEIN: DNA (cyt | 0.995 | 0.763 | 0.522 | 1e-148 | |
| 340719551 | 1442 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.977 | 0.330 | 0.524 | 1e-148 | |
| 383862947 | 1440 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.969 | 0.327 | 0.514 | 1e-148 | |
| 350410581 | 1441 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.977 | 0.330 | 0.520 | 1e-147 | |
| 156365066 | 1263 | predicted protein [Nematostella vectensi | 0.960 | 0.370 | 0.541 | 1e-146 | |
| 260806879 | 1275 | hypothetical protein BRAFLDRAFT_204680 [ | 0.977 | 0.373 | 0.544 | 1e-146 |
| >gi|350422372|ref|XP_003493144.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Score = 553 bits (1425), Expect = e-155, Method: Compositional matrix adjust.
Identities = 263/494 (53%), Positives = 348/494 (70%), Gaps = 7/494 (1%)
Query: 1 LYYNCVSYEGEQYKLKSCVYVNPDCFKFKSKP-QSAVQNNKRPVEDEELYPEAYRKLSDY 59
+ Y V Y+GE Y++ + V++ P F FK K +Q K+ DE++YPE YRK SD+
Sbjct: 670 VIYGLVKYKGEDYRVGTTVFLQPKAFNFKYKIIHQDIQKLKQENVDEDMYPEFYRKSSDH 729
Query: 60 MKGSNAYTPAPFGIGYIVAIFKKKGKKNVSASDVFLTVKKFYRPENTHRSVEFTYQLDLN 119
+KGSN TP PF IGYI I+ V+ SD+ + V K YRPENTH++V Q DLN
Sbjct: 730 VKGSNFDTPDPFCIGYINEIYVSTNDMLVAPSDIKIKVNKLYRPENTHKNVTLMEQADLN 789
Query: 120 KLYWSDEEEQVSLSDVQGKCFVVCEDNLQISTDRWSSRGPHRFYFNEAYNSKTEEFTNLP 179
+YWSDE + +V GKC++ +NL + D W++ GP+RFYFNEAYN++ + F P
Sbjct: 790 MVYWSDEVCNIKFIEVVGKCYLAYSENLNQTVDEWTAEGPNRFYFNEAYNAQEKTFNEPP 849
Query: 180 TEALFLGSVSKGKGKGKNQTNKPEEKDEIT------EWPSIARPLRCLEVFAGAGGLSRG 233
A+ +G K KG K + K EE ++ E+ I++ L+ L+VFAG GGLS G
Sbjct: 850 YHAISIGKSGKSKGNLKFKGKKTEESEKRAFVSRPIEYNKISKKLKTLDVFAGCGGLSEG 909
Query: 234 LDKSGVARSTWAIEFDSAAATAFKMNNPGCTVFVDDCNKILQRVIDNEVCDDKKQKLPRK 293
L ++G+A + WAIE + AAA A+++NNP TVF DDCN +L++V+D E ++ QKLP+K
Sbjct: 910 LHQAGIAENLWAIEKEEAAANAYRLNNPNTTVFTDDCNILLKKVMDGETTNEIGQKLPQK 969
Query: 294 GEVEMLCGGPPCQGFSGMNRFNQRQYSAFKNSLIVSYLSYCDYYRPRFFLLENVRNFVAF 353
G+VE+LCGGPPCQGFSGMNRFN RQYS FKNSL+VSYLSYCDYYRP FF++ENVRNFV+F
Sbjct: 970 GQVELLCGGPPCQGFSGMNRFNSRQYSLFKNSLVVSYLSYCDYYRPNFFIMENVRNFVSF 1029
Query: 354 KNSMVLKMTMRCLTQIGYQCTFGTLQAGHFGVSQTRRRAIVLAAAPGEVLPKYPEPWTVF 413
K SMVLK+T+RCL ++GYQCTFG LQAG++GV QTRRR I+LAAAPG++LP+YPEP VF
Sbjct: 1030 KRSMVLKLTLRCLVRMGYQCTFGILQAGNYGVPQTRRRIIILAAAPGQILPQYPEPTHVF 1089
Query: 414 SPRTSQLNVTISKKTYVSTCKWTQSAPYRTITVRDVMSDLPEIQNGCKMEELPYKENALS 473
S R QL+V + K Y + C WT+SAP+RTI+VRD + DLPEI+NG EE+ Y +A+S
Sbjct: 1090 SKRACQLSVLVDNKKYSTNCSWTESAPFRTISVRDALFDLPEIKNGWNKEEMSYTNDAIS 1149
Query: 474 HFQREKVWKCYSKI 487
HFQR K Y +
Sbjct: 1150 HFQRRIRGKQYQPL 1163
|
Source: Bombus impatiens Species: Bombus impatiens Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383852983|ref|XP_003702004.1| PREDICTED: DNA (cytosine-5)-methyltransferase PliMCI-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|283549178|ref|NP_001164522.1| DNA methyltransferase 1a [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|110765384|ref|XP_001122269.1| PREDICTED: DNA (cytosine-5)-methyltransferase PliMCI [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340728437|ref|XP_003402531.1| PREDICTED: LOW QUALITY PROTEIN: DNA (cytosine-5)-methyltransferase 1-like, partial [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340719551|ref|XP_003398214.1| PREDICTED: DNA (cytosine-5)-methyltransferase PliMCI-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383862947|ref|XP_003706944.1| PREDICTED: DNA (cytosine-5)-methyltransferase PliMCI-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350410581|ref|XP_003489082.1| PREDICTED: DNA (cytosine-5)-methyltransferase PliMCI-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|156365066|ref|XP_001626663.1| predicted protein [Nematostella vectensis] gi|156213548|gb|EDO34563.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|260806879|ref|XP_002598311.1| hypothetical protein BRAFLDRAFT_204680 [Branchiostoma floridae] gi|229283583|gb|EEN54323.1| hypothetical protein BRAFLDRAFT_204680 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 487 | ||||||
| MGI|MGI:94912 | 1620 | Dnmt1 "DNA methyltransferase ( | 0.969 | 0.291 | 0.541 | 3.5e-137 | |
| ZFIN|ZDB-GENE-990714-15 | 1500 | dnmt1 "DNA (cytosine-5-)-methy | 0.979 | 0.318 | 0.530 | 6.6e-136 | |
| UNIPROTKB|Q92072 | 1537 | DNMT1 "DNA (cytosine-5)-methyl | 0.977 | 0.309 | 0.534 | 6.7e-134 | |
| UNIPROTKB|Q24K09 | 1611 | DNMT1 "DNA (cytosine-5)-methyl | 0.969 | 0.292 | 0.538 | 1.1e-133 | |
| UNIPROTKB|F1S3I5 | 1611 | DNMT1 "Cytosine-specific methy | 0.965 | 0.291 | 0.536 | 1.1e-133 | |
| RGD|620979 | 1622 | Dnmt1 "DNA (cytosine-5-)-methy | 0.963 | 0.289 | 0.532 | 4.7e-133 | |
| UNIPROTKB|Q9Z330 | 1622 | Dnmt1 "DNA (cytosine-5)-methyl | 0.963 | 0.289 | 0.532 | 4.7e-133 | |
| UNIPROTKB|E2RHC6 | 1613 | DNMT1 "Cytosine-specific methy | 0.967 | 0.292 | 0.524 | 8.7e-132 | |
| UNIPROTKB|F5GX68 | 1619 | DNMT1 "Cytosine-specific methy | 0.969 | 0.291 | 0.530 | 2.3e-131 | |
| UNIPROTKB|P26358 | 1616 | DNMT1 "DNA (cytosine-5)-methyl | 0.969 | 0.292 | 0.530 | 2.3e-131 |
| MGI|MGI:94912 Dnmt1 "DNA methyltransferase (cytosine-5) 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Score = 1317 (468.7 bits), Expect = 3.5e-137, Sum P(2) = 3.5e-137
Identities = 262/484 (54%), Positives = 330/484 (68%)
Query: 1 LYYNCVSYEGEQYKLKSCVYVNPDCFKFKSKPQSAVQNNKRPVEDEELYPEAYRKLSDYM 60
+Y + ++ G Y+L VY+ P+ F F K S V+ K+ +E LYPE YRK SDY+
Sbjct: 925 VYCSSITKNGVVYRLGDSVYLPPEAFTFNIKVASPVKRPKKDPVNETLYPEHYRKYSDYI 984
Query: 61 KGSNAYTPAPFGIGYIVAIF--KKKGKKNVSASDVFLTVKKFYRPENTHRSVEFTYQLDL 118
KGSN P P+ IG I I KKKGK V+ +D+ L + KFYRPENTHRS +Y D+
Sbjct: 985 KGSNLDAPEPYRIGRIKEIHCGKKKGK--VNEADIKLRLYKFYRPENTHRSYNGSYHTDI 1042
Query: 119 NKLYWSDEEEQVSLSDVQGKCFVVCEDNLQISTDRWSSRGPHRFYFNEAYNSKTEEFTNL 178
N LYWSDEE V+ SDVQG+C V ++L S +S GP RFYF EAYNSKT+ F +
Sbjct: 1043 NMLYWSDEEAVVNFSDVQGRCTVEYGEDLLESIQDYSQGGPDRFYFLEAYNSKTKNFEDP 1102
Query: 179 PTEALFLXXXXXXXXXXX----NQTNKPEEKDEITEWPSIARPLRCLEVFAGAGGLSRGL 234
P A +Q ++P+E + + P LR L+VF+G GGLS G
Sbjct: 1103 PNHARSPGNKGKGKGKGKGKGKHQVSEPKEPEAAIKLPK----LRTLDVFSGCGGLSEGF 1158
Query: 235 DKSGVARSTWAIEFDSAAATAFKMNNPGCTVFVDDCNKILQRVIDNEVCDDKKQKLPRKG 294
++G++ + WAIE AA AF++NNPG TVF +DCN +L+ V+ EV + Q+LP+KG
Sbjct: 1159 HQAGISETLWAIEMWDPAAQAFRLNNPGTTVFTEDCNVLLKLVMAGEVTNSLGQRLPQKG 1218
Query: 295 EVEMLCGGPPCQGFSGMNRFNQRQYSAFKNSLIVSYLSYCDYYRPRFFLLENVRNFVAFK 354
+VEMLCGGPPCQGFSGMNRFN R YS FKNSL+VS+LSYCDYYRPRFFLLENVRNFV+++
Sbjct: 1219 DVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSYR 1278
Query: 355 NSMVLKMTMRCLTQIGYQCTFGTLQAGHFGVSQTRRRAIVLAAAPGEVLPKYPEPWTVFS 414
SMVLK+T+RCL ++GYQCTFG LQAG +GV+QTRRRAI+LAAAPGE LP +PEP VF+
Sbjct: 1279 RSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFA 1338
Query: 415 PRTSQLNVTISKKTYVSTCKWTQSAPYRTITVRDVMSDLPEIQNGCKMEELPYKENALSH 474
PR QL+V + K +VS S P+RTITVRD MSDLPEIQNG E+PY LS
Sbjct: 1339 PRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEIQNGASNSEIPYNGEPLSW 1398
Query: 475 FQRE 478
FQR+
Sbjct: 1399 FQRQ 1402
|
|
| ZFIN|ZDB-GENE-990714-15 dnmt1 "DNA (cytosine-5-)-methyltransferase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92072 DNMT1 "DNA (cytosine-5)-methyltransferase 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q24K09 DNMT1 "DNA (cytosine-5)-methyltransferase 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S3I5 DNMT1 "Cytosine-specific methyltransferase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|620979 Dnmt1 "DNA (cytosine-5-)-methyltransferase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Z330 Dnmt1 "DNA (cytosine-5)-methyltransferase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RHC6 DNMT1 "Cytosine-specific methyltransferase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GX68 DNMT1 "Cytosine-specific methyltransferase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P26358 DNMT1 "DNA (cytosine-5)-methyltransferase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P13864 | DNMT1_MOUSE | 2, ., 1, ., 1, ., 3, 7 | 0.5458 | 0.9917 | 0.2981 | yes | N/A |
| Q9Z330 | DNMT1_RAT | 2, ., 1, ., 1, ., 3, 7 | 0.5439 | 0.9568 | 0.2872 | yes | N/A |
| P26358 | DNMT1_HUMAN | 2, ., 1, ., 1, ., 3, 7 | 0.5264 | 0.9897 | 0.2982 | yes | N/A |
| Q24K09 | DNMT1_BOVIN | 2, ., 1, ., 1, ., 3, 7 | 0.5264 | 0.9917 | 0.2998 | yes | N/A |
| Q92072 | DNMT1_CHICK | 2, ., 1, ., 1, ., 3, 7 | 0.5450 | 0.9712 | 0.3077 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.1.1.37 | LOW CONFIDENCE prediction! |
| 3rd Layer | 2.1.1 | 0.691 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 487 | |||
| cd04711 | 137 | cd04711, BAH_Dnmt1_II, BAH, or Bromo Adjacent Homo | 2e-51 | |
| COG0270 | 328 | COG0270, Dcm, Site-specific DNA methylase [DNA rep | 2e-26 | |
| cd00315 | 275 | cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi | 5e-26 | |
| pfam00145 | 320 | pfam00145, DNA_methylase, C-5 cytosine-specific DN | 4e-25 | |
| smart00439 | 121 | smart00439, BAH, Bromo adjacent homology domain | 1e-19 | |
| TIGR00675 | 315 | TIGR00675, dcm, DNA-methyltransferase (dcm) | 2e-19 | |
| pfam01426 | 120 | pfam01426, BAH, BAH domain | 2e-17 | |
| cd04708 | 202 | cd04708, BAH_plantDCM_II, BAH, or Bromo Adjacent H | 7e-13 | |
| cd04370 | 123 | cd04370, BAH, BAH, or Bromo Adjacent Homology doma | 4e-12 | |
| cd04710 | 135 | cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Hom | 4e-04 | |
| PRK10458 | 467 | PRK10458, PRK10458, DNA cytosine methylase; Provis | 0.001 |
| >gnl|CDD|240062 cd04711, BAH_Dnmt1_II, BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
Score = 170 bits (433), Expect = 2e-51
Identities = 72/136 (52%), Positives = 88/136 (64%), Gaps = 1/136 (0%)
Query: 45 DEELYPEAYRKLSDYMKGSNAYTPAPFGIGYIVAIF-KKKGKKNVSASDVFLTVKKFYRP 103
DE+LYPE YRK SDY+KGSN P PF IG I IF K+ + SD+ L + KFYRP
Sbjct: 1 DEDLYPEYYRKSSDYIKGSNLDAPEPFRIGRIKEIFCAKRSNGKPNESDIKLRINKFYRP 60
Query: 104 ENTHRSVEFTYQLDLNKLYWSDEEEQVSLSDVQGKCFVVCEDNLQISTDRWSSRGPHRFY 163
ENTH+ + TY D+N LYWSDEE V S VQG+C V ++L S +S GP RFY
Sbjct: 61 ENTHKGFKATYHADINMLYWSDEEATVDFSAVQGRCTVEYGEDLPESVQEYSGGGPDRFY 120
Query: 164 FNEAYNSKTEEFTNLP 179
F EAYN+KT+ F + P
Sbjct: 121 FLEAYNAKTKSFEDPP 136
|
DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the genome. These effects include transcriptional repression via inhibition of transcription factor binding, the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting, and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 137 |
| >gnl|CDD|223348 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >gnl|CDD|215747 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase | Back alignment and domain information |
|---|
| >gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|233085 TIGR00675, dcm, DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >gnl|CDD|216495 pfam01426, BAH, BAH domain | Back alignment and domain information |
|---|
| >gnl|CDD|240059 cd04708, BAH_plantDCM_II, BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
| >gnl|CDD|240061 cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains | Back alignment and domain information |
|---|
| >gnl|CDD|236696 PRK10458, PRK10458, DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 487 | |||
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 100.0 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 100.0 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 100.0 | |
| COG0270 | 328 | Dcm Site-specific DNA methylase [DNA replication, | 100.0 | |
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 100.0 | |
| cd04708 | 202 | BAH_plantDCM_II BAH, or Bromo Adjacent Homology do | 100.0 | |
| cd04711 | 137 | BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai | 100.0 | |
| cd04710 | 135 | BAH_fungalPHD BAH, or Bromo Adjacent Homology doma | 99.96 | |
| cd04716 | 122 | BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom | 99.96 | |
| cd04709 | 164 | BAH_MTA BAH, or Bromo Adjacent Homology domain, as | 99.93 | |
| cd04760 | 124 | BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain | 99.93 | |
| cd04713 | 146 | BAH_plant_3 BAH, or Bromo Adjacent Homology domain | 99.92 | |
| PF01426 | 119 | BAH: BAH domain; InterPro: IPR001025 The BAH (brom | 99.92 | |
| cd04714 | 121 | BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, | 99.91 | |
| smart00439 | 120 | BAH Bromo adjacent homology domain. | 99.91 | |
| cd04712 | 130 | BAH_DCM_I BAH, or Bromo Adjacent Homology domain, | 99.9 | |
| cd04717 | 121 | BAH_polybromo BAH, or Bromo Adjacent Homology doma | 99.9 | |
| cd04370 | 123 | BAH BAH, or Bromo Adjacent Homology domain (also c | 99.9 | |
| cd04715 | 159 | BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom | 99.88 | |
| KOG0919|consensus | 338 | 99.86 | ||
| cd04721 | 130 | BAH_plant_1 BAH, or Bromo Adjacent Homology domain | 99.83 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 99.75 | |
| cd04720 | 179 | BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do | 99.67 | |
| cd04719 | 128 | BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d | 99.66 | |
| KOG1886|consensus | 464 | 99.5 | ||
| KOG1827|consensus | 629 | 99.25 | ||
| KOG3554|consensus | 693 | 99.03 | ||
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 97.86 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 97.83 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 97.74 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 97.73 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 97.7 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 97.7 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 97.62 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 97.55 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 97.55 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 97.47 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 97.42 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 97.41 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 97.33 | |
| KOG3420|consensus | 185 | 97.32 | ||
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 97.29 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 97.18 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 97.16 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 97.13 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 97.12 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 97.09 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 97.06 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 96.98 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 96.97 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 96.89 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 96.83 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 96.73 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 96.72 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 96.7 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 96.67 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 96.62 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 96.61 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 96.59 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 96.59 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 96.52 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 96.51 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 96.47 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 96.45 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 96.39 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 96.15 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 96.14 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 96.12 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 96.08 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 96.07 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 96.07 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 96.01 | |
| KOG2730|consensus | 263 | 95.99 | ||
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 95.97 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 95.9 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 95.85 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 95.81 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 95.8 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 95.79 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 95.65 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 95.53 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 95.42 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 95.31 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 95.26 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 94.98 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 94.94 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 94.83 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 94.58 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 94.56 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 94.47 | |
| KOG1227|consensus | 351 | 94.27 | ||
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 94.2 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 94.12 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 93.98 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 93.96 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 93.87 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 93.65 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 93.65 | |
| PRK04266 | 226 | fibrillarin; Provisional | 93.41 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 93.33 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 93.27 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 93.25 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 93.17 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 93.12 | |
| PLN02823 | 336 | spermine synthase | 92.98 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 92.94 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 92.93 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 92.9 | |
| KOG2904|consensus | 328 | 92.72 | ||
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 92.6 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 92.57 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 92.47 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 92.38 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 92.23 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 92.1 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 91.94 | |
| KOG3191|consensus | 209 | 91.87 | ||
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 91.76 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 91.71 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 91.52 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 90.89 | |
| PLN02366 | 308 | spermidine synthase | 90.67 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 90.59 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 90.56 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 90.44 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 90.4 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 90.29 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 90.04 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 89.9 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 89.89 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 89.85 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 89.74 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 89.72 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 89.64 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 89.64 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 89.56 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 89.46 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 88.5 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 88.44 | |
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 88.34 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 88.33 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 88.29 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 87.63 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 87.33 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 87.29 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 87.25 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 87.05 | |
| KOG2078|consensus | 495 | 86.96 | ||
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 86.93 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 86.76 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 86.63 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 86.55 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 86.49 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 86.45 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 86.39 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 85.93 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 85.34 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 85.26 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 85.25 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 85.19 | |
| PF02086 | 260 | MethyltransfD12: D12 class N6 adenine-specific DNA | 85.15 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 84.91 | |
| KOG2187|consensus | 534 | 84.78 | ||
| PF01555 | 231 | N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th | 84.7 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 84.33 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 83.91 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 83.88 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 83.47 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 83.47 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 83.4 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 83.39 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 83.28 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 83.19 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 82.63 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 82.49 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 82.39 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 81.65 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 81.43 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 81.42 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 80.64 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 80.62 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 80.48 | |
| COG3897 | 218 | Predicted methyltransferase [General function pred | 80.13 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 80.05 |
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.7e-46 Score=375.53 Aligned_cols=168 Identities=35% Similarity=0.711 Sum_probs=145.7
Q ss_pred CeEeecccCchHHHHHHhhcCCCcEEEEEcCcHHHHHHHHHhCCCCceeccchHHHHHHhhchhhhccccccCCCCCccc
Q psy13720 218 LRCLEVFAGAGGLSRGLDKSGVARSTWAIEFDSAAATAFKMNNPGCTVFVDDCNKILQRVIDNEVCDDKKQKLPRKGEVE 297 (487)
Q Consensus 218 l~~ldLFsG~Gg~s~Gl~~aG~~~~~~a~e~~~~a~~t~~~N~p~~~~~~~di~~~~~~~~~~~~~~~~~~~~p~~~~vd 297 (487)
++++||||||||+++||++||+ +++||+|+|+.|++||++||| .+..+||.++... .+|. ++|
T Consensus 1 ~~~~dlFsG~Gg~~~g~~~ag~-~~~~a~e~~~~a~~~y~~N~~--~~~~~Di~~~~~~------------~l~~--~~D 63 (335)
T PF00145_consen 1 MKVIDLFSGIGGFSLGLEQAGF-EVVWAVEIDPDACETYKANFP--EVICGDITEIDPS------------DLPK--DVD 63 (335)
T ss_dssp EEEEEET-TTTHHHHHHHHTTE-EEEEEEESSHHHHHHHHHHHT--EEEESHGGGCHHH------------HHHH--T-S
T ss_pred CcEEEEccCccHHHHHHHhcCc-EEEEEeecCHHHHHhhhhccc--ccccccccccccc------------cccc--cce
Confidence 5899999999999999999997 999999999999999999999 7888898876321 2342 599
Q ss_pred EEEccCCCcCcccCCccCCcccccchhHHHHHHHHHhhhcCCcEEEEecCcchhcccchhHHHHHHHHHHhCCCeeEEEE
Q psy13720 298 MLCGGPPCQGFSGMNRFNQRQYSAFKNSLIVSYLSYCDYYRPRFFLLENVRNFVAFKNSMVLKMTMRCLTQIGYQCTFGT 377 (487)
Q Consensus 298 ~i~ggpPCq~fS~~~~~~~~~~~d~r~~L~~~~l~~v~~~~P~~~ilENV~gl~~~~~~~~~~~i~~~l~~~GY~~~~~~ 377 (487)
||+||||||+||.+|+. +..+|.|+.|+++++++|+.++|++|+||||+||++.+++..++.+++.|+++||++.+.+
T Consensus 64 ~l~ggpPCQ~fS~ag~~--~~~~d~r~~L~~~~~~~v~~~~Pk~~~~ENV~~l~~~~~~~~~~~i~~~l~~lGY~v~~~v 141 (335)
T PF00145_consen 64 LLIGGPPCQGFSIAGKR--KGFDDPRNSLFFEFLRIVKELKPKYFLLENVPGLLSSKNGEVFKEILEELEELGYNVQWRV 141 (335)
T ss_dssp EEEEE---TTTSTTSTH--HCCCCHTTSHHHHHHHHHHHHS-SEEEEEEEGGGGTGGGHHHHHHHHHHHHHTTEEEEEEE
T ss_pred EEEeccCCceEeccccc--cccccccchhhHHHHHHHhhccceEEEecccceeeccccccccccccccccccceeehhcc
Confidence 99999999999999963 4567899999999999999999999999999999999888999999999999999999999
Q ss_pred EeccCCCCCCcccEEEEEEEcCCCCCC
Q psy13720 378 LQAGHFGVSQTRRRAIVLAAAPGEVLP 404 (487)
Q Consensus 378 l~a~~yGvPQ~R~R~fiia~~~~~~~p 404 (487)
|||++|||||+|+|+||||++++...+
T Consensus 142 lna~~yGvPQ~R~R~fivg~r~~~~~~ 168 (335)
T PF00145_consen 142 LNAADYGVPQNRERVFIVGIRKDLPLP 168 (335)
T ss_dssp EEGGGGTSSBE-EEEEEEEEEGGG--T
T ss_pred ccHhhCCCCCceeeEEEEEECCCCCcc
Confidence 999999999999999999999986654
|
1.1.37 from EC) (C5 Mtase) are enzymes that specifically methylate the C-5 carbon of cytosines in DNA to produce C5-methylcytosine [, , ]. In mammalian cells, cytosine-specific methyltransferases methylate certain CpG sequences, which are believed to modulate gene expression and cell differentiation. In bacteria, these enzymes are a component of restriction-modification systems and serve as valuable tools for the manipulation of DNA [, ]. The structure of HhaI methyltransferase (M.HhaI) has been resolved to 2.5 A []: the molecule folds into 2 domains - a larger catalytic domain containing catalytic and cofactor binding sites, and a smaller DNA recognition domain.; GO: 0003677 DNA binding, 0006306 DNA methylation; PDB: 4DA4_A 3PT6_B 3AV6_A 3AV5_A 3AV4_A 3PT9_A 1DCT_A 3LX6_A 3ME5_A 2QRV_A .... |
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains | Back alignment and domain information |
|---|
| >cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins | Back alignment and domain information |
|---|
| >cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation | Back alignment and domain information |
|---|
| >cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins | Back alignment and domain information |
|---|
| >smart00439 BAH Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 | Back alignment and domain information |
|---|
| >cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 | Back alignment and domain information |
|---|
| >cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
| >cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins | Back alignment and domain information |
|---|
| >KOG0919|consensus | Back alignment and domain information |
|---|
| >cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p | Back alignment and domain information |
|---|
| >cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p | Back alignment and domain information |
|---|
| >KOG1886|consensus | Back alignment and domain information |
|---|
| >KOG1827|consensus | Back alignment and domain information |
|---|
| >KOG3554|consensus | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3420|consensus | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >KOG2730|consensus | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >KOG1227|consensus | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >KOG2904|consensus | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3191|consensus | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >KOG2078|consensus | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG2187|consensus | Back alignment and domain information |
|---|
| >PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG3897 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 487 | ||||
| 3av4_A | 1330 | Crystal Structure Of Mouse Dna Methyltransferase 1 | 1e-148 | ||
| 3pt9_A | 873 | Crystal Structure Of Mouse Dnmt1(731-1602) In The F | 1e-147 | ||
| 3pt6_A | 954 | Crystal Structure Of Mouse Dnmt1(650-1602) In Compl | 1e-147 | ||
| 3swr_A | 1002 | Structure Of Human Dnmt1 (601-1600) In Complex With | 1e-140 | ||
| 3pta_A | 956 | Crystal Structure Of Human Dnmt1(646-1600) In Compl | 1e-140 | ||
| 4ft2_A | 784 | Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 | 2e-26 | ||
| 4fsx_A | 784 | Crystal Structure Of Se-Substituted Zea Mays Zmet2 | 2e-24 | ||
| 1dct_A | 324 | Dna (Cytosine-5) Methylase From Haeiii Covalently B | 1e-10 | ||
| 1g55_A | 343 | Structure Of Human Dnmt2, An Enigmatic Dna Methyltr | 1e-10 | ||
| 2uyh_A | 327 | Hhai Dna Methyltransferase S87q-Q237s Mutant Comple | 6e-10 | ||
| 3me5_A | 482 | Crystal Structure Of Putative Dna Cytosine Methylas | 7e-10 | ||
| 3lx6_A | 410 | Crystal Structure Of Putative Dna Cytosine Methylas | 7e-10 | ||
| 1mht_A | 327 | Covalent Ternary Structure Of Hhai Methyltransferas | 9e-10 | ||
| 1fjx_A | 327 | Structure Of Ternary Complex Of Hhai Methyltransfer | 9e-10 | ||
| 1svu_A | 327 | Structure Of The Q237w Mutant Of Hhai Dna Methyltra | 1e-09 | ||
| 3ubt_Y | 331 | Crystal Structure Of C71s Mutant Of Dna Cytosine-5 | 1e-09 | ||
| 2z6q_A | 327 | Ternary Structure Of Arg165ala M.Hhai C5-Cytosine D | 2e-09 | ||
| 2zcj_A | 327 | Ternary Structure Of The Glu119gln M.Hhai, C5-Cytos | 2e-09 | ||
| 2uz4_A | 327 | Hhai Dna Methyltransferase R165n Mutant Complex Wit | 4e-09 | ||
| 2uyc_A | 327 | Hhai Dna Methyltransferase R163n Mutant Complex Wit | 4e-09 | ||
| 2z6u_A | 327 | Ternary Structure Of The Glu119ala M.Hhai, C5-Cytos | 5e-09 | ||
| 3g7u_A | 376 | Crystal Structure Of Putative Dna Modification Meth | 6e-09 | ||
| 2z6a_A | 327 | S-Adenosyl-L-Methionine-Dependent Methyl Transfer: | 9e-09 | ||
| 2i9k_A | 327 | Engineered Extrahelical Base Destabilization Enhanc | 1e-08 | ||
| 4h0n_A | 333 | Crystal Structure Of Spodoptera Frugiperda Dnmt2 E2 | 8e-04 |
| >pdb|3AV4|A Chain A, Crystal Structure Of Mouse Dna Methyltransferase 1 Length = 1330 | Back alignment and structure |
|
| >pdb|3PT9|A Chain A, Crystal Structure Of Mouse Dnmt1(731-1602) In The Free State Length = 873 | Back alignment and structure |
| >pdb|3PT6|A Chain A, Crystal Structure Of Mouse Dnmt1(650-1602) In Complex With Dna Length = 954 | Back alignment and structure |
| >pdb|3SWR|A Chain A, Structure Of Human Dnmt1 (601-1600) In Complex With Sinefungin Length = 1002 | Back alignment and structure |
| >pdb|3PTA|A Chain A, Crystal Structure Of Human Dnmt1(646-1600) In Complex With Dna Length = 956 | Back alignment and structure |
| >pdb|4FT2|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 Peptide And Sah Length = 784 | Back alignment and structure |
| >pdb|4FSX|A Chain A, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In Complex With Sah Length = 784 | Back alignment and structure |
| >pdb|1DCT|A Chain A, Dna (Cytosine-5) Methylase From Haeiii Covalently Bound To Dna Length = 324 | Back alignment and structure |
| >pdb|1G55|A Chain A, Structure Of Human Dnmt2, An Enigmatic Dna Methyltransferase Homologue Length = 343 | Back alignment and structure |
| >pdb|2UYH|A Chain A, Hhai Dna Methyltransferase S87q-Q237s Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 | Back alignment and structure |
| >pdb|3ME5|A Chain A, Crystal Structure Of Putative Dna Cytosine Methylase From Shigella Flexneri 2a Str. 2457t Length = 482 | Back alignment and structure |
| >pdb|3LX6|A Chain A, Crystal Structure Of Putative Dna Cytosine Methylase From Shigella Flexneri 2a Str. 2457t Length = 410 | Back alignment and structure |
| >pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna And S-Adenosyl-L-Homocysteine Length = 327 | Back alignment and structure |
| >pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase Mutant (T250g) In Complex With Dna And Adohcy Length = 327 | Back alignment and structure |
| >pdb|1SVU|A Chain A, Structure Of The Q237w Mutant Of Hhai Dna Methyltransferase: An Insight Into Protein-Protein Interactions Length = 327 | Back alignment and structure |
| >pdb|3UBT|Y Chain Y, Crystal Structure Of C71s Mutant Of Dna Cytosine-5 Methyltransferase M.Haeiii Bound To Dna Length = 331 | Back alignment and structure |
| >pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna Methyltransferase With Unmodified Dna And Adohcy Length = 327 | Back alignment and structure |
| >pdb|2ZCJ|A Chain A, Ternary Structure Of The Glu119gln M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 | Back alignment and structure |
| >pdb|2UZ4|A Chain A, Hhai Dna Methyltransferase R165n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 | Back alignment and structure |
| >pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 | Back alignment and structure |
| >pdb|2Z6U|A Chain A, Ternary Structure Of The Glu119ala M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 | Back alignment and structure |
| >pdb|3G7U|A Chain A, Crystal Structure Of Putative Dna Modification Methyltransferase Encoded Within Prophage Cp-933r (E.Coli) Length = 376 | Back alignment and structure |
| >pdb|2Z6A|A Chain A, S-Adenosyl-L-Methionine-Dependent Methyl Transfer: Observable Precatalytic Intermediates During Dna Cytosine Methylation Length = 327 | Back alignment and structure |
| >pdb|2I9K|A Chain A, Engineered Extrahelical Base Destabilization Enhances Sequence Discrimination Of Dna Methyltransferase M.Hhai Length = 327 | Back alignment and structure |
| >pdb|4H0N|A Chain A, Crystal Structure Of Spodoptera Frugiperda Dnmt2 E260a/e261a/k263a Mutant Length = 333 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
Score = 452 bits (1162), Expect = e-149
Identities = 256/487 (52%), Positives = 324/487 (66%), Gaps = 1/487 (0%)
Query: 2 YYNCVSYEGEQYKLKSCVYVNPDCFKFKSKPQSAVQNNKRPVEDEELYPEAYRKLSDYMK 61
Y + G Y++ VY+ P+ F F K S V+ ++ DE+LYPE YRK SDY+K
Sbjct: 324 LYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIK 383
Query: 62 GSNAYTPAPFGIGYIVAIF-KKKGKKNVSASDVFLTVKKFYRPENTHRSVEFTYQLDLNK 120
GSN P P+ IG I IF KK + +D+ + V KFYRPENTH+S +Y D+N
Sbjct: 384 GSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINL 443
Query: 121 LYWSDEEEQVSLSDVQGKCFVVCEDNLQISTDRWSSRGPHRFYFNEAYNSKTEEFTNLPT 180
LYWSDEE V VQG+C V ++L +S GP+RFYF EAYN+K++ F + P
Sbjct: 444 LYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPN 503
Query: 181 EALFLGSVSKGKGKGKNQTNKPEEKDEITEWPSIARPLRCLEVFAGAGGLSRGLDKSGVA 240
A G+ KGKGKGK + + E LR L+VF+G GGLS G ++G++
Sbjct: 504 HARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGIS 563
Query: 241 RSTWAIEFDSAAATAFKMNNPGCTVFVDDCNKILQRVIDNEVCDDKKQKLPRKGEVEMLC 300
+ WAIE AA AF++NNPG TVF +DCN +L+ V+ E + + Q+LP+KG+VEMLC
Sbjct: 564 DTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLC 623
Query: 301 GGPPCQGFSGMNRFNQRQYSAFKNSLIVSYLSYCDYYRPRFFLLENVRNFVAFKNSMVLK 360
GGPPCQGFSGMNRFN R YS FKNSL+VS+LSYCDYYRPRFFLLENVRNFV+FK SMVLK
Sbjct: 624 GGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLK 683
Query: 361 MTMRCLTQIGYQCTFGTLQAGHFGVSQTRRRAIVLAAAPGEVLPKYPEPWTVFSPRTSQL 420
+T+RCL ++GYQCTFG LQAG +GV+QTRRRAI+LAAAPGE LP +PEP VF+PR QL
Sbjct: 684 LTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQL 743
Query: 421 NVTISKKTYVSTCKWTQSAPYRTITVRDVMSDLPEIQNGCKMEELPYKENALSHFQREKV 480
+V + K +VS S P+RTITVRD MSDLPE++NG E+ Y S FQR+
Sbjct: 744 SVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLR 803
Query: 481 WKCYSKI 487
Y I
Sbjct: 804 GAQYQPI 810
|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376 | Back alignment and structure |
|---|
| >1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324 | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327 | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482 | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327 | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 230 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Length = 201 | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Length = 189 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 487 | |||
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 100.0 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 100.0 | |
| 4ft4_B | 784 | DNA (cytosine-5)-methyltransferase 1; chromodomain | 100.0 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 100.0 | |
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 100.0 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 100.0 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 100.0 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 100.0 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 100.0 | |
| 4dkj_A | 403 | Cytosine-specific methyltransferase; CG-specificit | 100.0 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 100.0 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 100.0 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 99.96 | |
| 2qrv_B | 230 | DNA (cytosine-5)-methyltransferase 3-like; DNA met | 99.96 | |
| 1w4s_A | 174 | Polybromo, polybromo 1 protein; BAH, bromo-associa | 99.95 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 99.89 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 99.87 | |
| 4dov_A | 163 | ORC1, origin recognition complex subunit 1; DNA re | 99.71 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 98.84 | |
| 2fl7_A | 232 | Regulatory protein SIR3; ORC, silencing, chromatin | 98.75 | |
| 1m4z_A | 238 | Origin recognition complex subunit 1; DNA replicat | 98.71 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 98.29 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 98.05 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 97.86 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 97.86 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 97.82 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 97.75 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 97.69 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 97.66 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 97.63 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 97.62 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 97.61 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 97.58 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 97.54 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 97.5 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 97.49 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 97.49 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 97.48 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 97.45 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 97.36 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 97.3 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 97.19 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 97.14 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 97.14 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 97.06 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 97.06 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 97.04 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 97.0 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 96.99 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 96.98 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 96.91 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 96.91 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 96.88 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 96.87 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 96.87 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 96.85 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 96.83 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 96.83 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 96.78 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 96.77 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 96.73 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 96.72 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 96.71 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 96.7 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 96.67 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 96.66 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 96.65 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 96.64 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 96.64 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 96.62 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 96.62 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 96.6 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 96.56 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 96.55 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 96.52 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 96.48 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 96.46 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 96.45 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 96.4 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 96.38 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 96.37 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 96.33 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 96.27 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 96.23 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 96.18 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 96.17 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 96.11 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 96.06 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 96.02 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 96.02 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 96.01 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 96.01 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 95.99 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 95.94 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 95.92 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 95.9 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 95.88 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 95.85 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 95.83 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 95.79 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 95.79 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 95.78 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 95.75 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 95.75 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 95.74 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 95.68 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 95.62 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 95.61 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 95.6 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 95.6 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 95.56 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 95.55 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 95.51 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 95.51 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 95.49 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 95.46 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 95.45 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 95.45 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 95.44 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 95.41 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 95.41 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 95.41 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 95.39 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 95.38 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 95.36 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 95.36 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 95.31 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 95.25 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 95.23 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 95.13 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 95.03 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 94.95 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 94.95 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 94.95 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 94.93 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 94.89 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 94.85 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 94.73 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 94.71 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 94.59 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 94.55 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 94.5 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 94.5 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 94.45 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 94.42 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 94.39 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 94.37 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 94.29 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 94.22 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 94.18 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 94.09 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 94.04 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 94.02 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 93.92 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 93.92 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 93.89 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 93.85 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 93.84 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 93.75 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 93.74 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 93.74 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 93.71 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 93.69 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 93.56 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 93.55 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 93.53 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 93.46 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 93.43 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 93.39 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 93.38 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 93.3 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 93.29 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 93.28 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 93.21 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 93.2 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 93.17 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 93.17 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 93.16 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 93.16 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 93.11 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 93.1 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 93.09 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 92.97 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 92.95 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 92.92 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 92.86 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 92.81 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 92.78 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 92.78 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 92.76 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 92.72 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 92.62 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 92.47 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 92.46 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 92.44 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 92.36 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 92.28 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 92.26 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 92.24 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 92.23 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 92.11 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 92.11 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 92.07 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 92.01 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 91.98 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 91.91 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 91.83 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 91.69 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 91.65 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 91.64 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 91.57 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 91.55 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 91.55 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 91.51 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 91.49 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 91.48 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 91.36 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 91.27 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 91.25 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 91.25 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 91.09 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 90.96 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 90.9 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 90.77 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 90.55 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 90.51 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 90.21 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 90.1 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 90.06 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 89.92 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 89.89 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 89.68 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 89.67 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 89.37 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 89.37 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 89.31 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 89.31 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 89.24 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 89.04 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 88.75 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 88.49 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 87.81 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 87.7 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 87.39 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 87.36 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 87.14 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 86.87 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 86.7 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 86.36 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 86.32 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 86.31 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 85.91 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 85.36 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 85.22 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 85.16 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 84.78 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 84.43 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 84.07 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 83.53 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 83.31 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 83.0 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 82.99 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 82.44 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 82.26 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 82.03 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 81.67 | |
| 1eg2_A | 319 | Modification methylase RSRI; rossmann fold, exocyc | 80.98 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 80.85 |
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-101 Score=864.79 Aligned_cols=484 Identities=53% Similarity=0.922 Sum_probs=424.4
Q ss_pred CeEeEEEEcCeEEeeCCeEEeCCCccccccCCccccccCCCCCCCCccchhhhcccCCceeccCCCCCCCceEEEEEEEE
Q psy13720 1 LYYNCVSYEGEQYKLKSCVYVNPDCFKFKSKPQSAVQNNKRPVEDEELYPEAYRKLSDYMKGSNAYTPAPFGIGYIVAIF 80 (487)
Q Consensus 1 ~~y~~v~~~g~~y~vGD~V~v~p~~~~~~~~~~~~~~~~~~~~~de~~~~e~~r~~~~~~~~~~~~~~~P~~IgrI~~i~ 80 (487)
++|+++.++|++|+|||+|||.|+.|.|+.++.++.+..+++++||++|||+|||.++|++|+|.++++||+||||++||
T Consensus 323 ~~~~~~~~~g~~y~vgD~Vyl~p~~~~f~~~~~~~~~~~~~~~vd~~~ype~yrk~~~~~kg~n~~~~~P~~IgrI~~i~ 402 (1002)
T 3swr_A 323 VLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIF 402 (1002)
T ss_dssp EEESEEEETTEEEETTCEEEECTTSCCCSSCCCCCCCCSCSCCCCTTTCTTSGGGHHHHHTCCCCCCCCCCEEEEEEEEE
T ss_pred EEEEEEEECCEEEecCCEEEECCcccccccccccccccccccccccccchhhhhccchhccccccCCCCCceeeEEeEEE
Confidence 48999999999999999999999999999999999887777899999999999999999999999999999999999999
Q ss_pred ecCCCC-CCCCCceEEEEEeeeccccCCCCccccccCCCceEEecccceeecccceeeeeEEEeecCCcccccccccCCC
Q psy13720 81 KKKGKK-NVSASDVFLTVKKFYRPENTHRSVEFTYQLDLNKLYWSDEEEQVSLSDVQGKCFVVCEDNLQISTDRWSSRGP 159 (487)
Q Consensus 81 ~~~~~~-~~~~~~~~v~v~wfyRp~dt~~~~~~~~~~d~reLF~S~~~d~vp~~~I~GKC~V~~~~~~~~~~~~~~~~~~ 159 (487)
.++++. ..+...++|+|+|||||+||+++....+++|.||||||++.+++|+++|+|||.|++.+++....++|...++
T Consensus 403 ~~~~~~~~~~~~~~~v~v~~fyRPed~~~~~~~~~~~D~~elf~S~~~~~~~~~~i~GkC~V~~~~d~~~~~~~~~~~~p 482 (1002)
T 3swr_A 403 CPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGP 482 (1002)
T ss_dssp ECCCSSSSCCSSCCEEEEEECBCGGGSTTCGGGGSSSCTTEEEECCCEEEEEGGGCCEEEEEEEGGGCSSCHHHHHHTSS
T ss_pred ecCCccccCCCccEEEEEEEEECcccccccccccccCCcceEEEecceeccCHHHcceEEEEEEeccccccchhhccCCC
Confidence 887643 3355679999999999999988778788899999999999999999999999999999999877778998888
Q ss_pred CeeEEEEeecCCCCccccCchhhhhcccccCCCCCCCCCCCC-CCcccccCCCCCcCCCCeEeecccCchHHHHHHhhcC
Q psy13720 160 HRFYFNEAYNSKTEEFTNLPTEALFLGSVSKGKGKGKNQTNK-PEEKDEITEWPSIARPLRCLEVFAGAGGLSRGLDKSG 238 (487)
Q Consensus 160 d~Fy~~~~Yd~~~~~f~~~P~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~l~~ldLFsG~Gg~s~Gl~~aG 238 (487)
|+|||.+.||+.+++|+.||.+++++++|.++|+++|...+. ..+.....+...+ .+++++||||||||+++||++||
T Consensus 483 ~~fyf~~~Yd~~~~~f~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~l~~iDLFaG~GGlslGl~~AG 561 (1002)
T 3swr_A 483 NRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKL-PKLRTLDVFSGCGGLSEGFHQAG 561 (1002)
T ss_dssp SEEEEEEEEETTTTEEECCCSTTSCC----------------------CCCCCCCC-CCEEEEEESCTTSHHHHHHHHHT
T ss_pred CeEEEEEEEeCCCCeeecCccccccccccccccccccccccccccccccccccccC-CCCeEEEeccCccHHHHHHHHCC
Confidence 999999999999999999999999999998888777665543 1111111233344 78999999999999999999999
Q ss_pred CCcEEEEEcCcHHHHHHHHHhCCCCceeccchHHHHHHhhchhhhccccccCCCCCcccEEEccCCCcCcccCCccCCcc
Q psy13720 239 VARSTWAIEFDSAAATAFKMNNPGCTVFVDDCNKILQRVIDNEVCDDKKQKLPRKGEVEMLCGGPPCQGFSGMNRFNQRQ 318 (487)
Q Consensus 239 ~~~~~~a~e~~~~a~~t~~~N~p~~~~~~~di~~~~~~~~~~~~~~~~~~~~p~~~~vd~i~ggpPCq~fS~~~~~~~~~ 318 (487)
+.+++||+|+|+.|++||++|||++.++++||++++..+..+++.+.....+|..+++|||+||||||+||.+|+.+.+.
T Consensus 562 ~~~vv~avEid~~A~~ty~~N~p~~~~~~~DI~~l~~~~~~~di~~~~~~~lp~~~~vDll~GGpPCQ~FS~ag~~~~~~ 641 (1002)
T 3swr_A 562 ISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRT 641 (1002)
T ss_dssp SEEEEEEECSSHHHHHHHHHHCTTSEEECSCHHHHHHHHHHTCSBCTTCCBCCCTTTCSEEEECCCCTTCCSSSCCCHHH
T ss_pred CCceEEEEECCHHHHHHHHHhCCCCccccccHHHHhhhccchhhhhhhhhhcccCCCeeEEEEcCCCcchhhhCCCCCCc
Confidence 75799999999999999999999999999999999877777777766666788788999999999999999999754455
Q ss_pred cccchhHHHHHHHHHhhhcCCcEEEEecCcchhcccchhHHHHHHHHHHhCCCeeEEEEEeccCCCCCCcccEEEEEEEc
Q psy13720 319 YSAFKNSLIVSYLSYCDYYRPRFFLLENVRNFVAFKNSMVLKMTMRCLTQIGYQCTFGTLQAGHFGVSQTRRRAIVLAAA 398 (487)
Q Consensus 319 ~~d~r~~L~~~~l~~v~~~~P~~~ilENV~gl~~~~~~~~~~~i~~~l~~~GY~~~~~~l~a~~yGvPQ~R~R~fiia~~ 398 (487)
.+|+|+.|+.+|+++|+.++|++||||||+||++++++..++.+++.|.++||++.+.+|||++|||||+|+|+||||++
T Consensus 642 ~~d~R~~L~~~~~riv~~~rPk~~llENV~glls~~~~~~~~~i~~~L~~lGY~v~~~vLnA~dyGvPQ~R~R~fiva~r 721 (1002)
T 3swr_A 642 YSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAA 721 (1002)
T ss_dssp HHHHTTSHHHHHHHHHHHHCCSEEEEEEEGGGGTTGGGHHHHHHHHHHHHHTCEEEEEEEEGGGGTCSBCCEEEEEEEEC
T ss_pred ccchhhHHHHHHHHHHHHhCCCEEEEeccHHHhccCcchHHHHHHHHHHhcCCeEEEEEEEHHHCCCCccceEEEEEEEe
Confidence 67889999999999999999999999999999999888999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCCCCCccCCCCCcccceecccccccccccccCCCCCCcccHHHHhcCCCCCCCCCCccccCCCCCCCCHHHHH
Q psy13720 399 PGEVLPKYPEPWTVFSPRTSQLNVTISKKTYVSTCKWTQSAPYRTITVRDVMSDLPEIQNGCKMEELPYKENALSHFQRE 478 (487)
Q Consensus 399 ~~~~~p~~P~pth~~~~~~~~l~~~~~~~~~~~~~~~~~~~p~~~vtv~dai~dLp~~~~g~~~~~~~y~~~p~~~~q~~ 478 (487)
+|..+|.+|.|||.+..+...|...++++.+.++..|....|++++||+|||+|||.+.+|+....++|...|.++||++
T Consensus 722 ~g~~~p~~P~pth~~~~~~~~l~~~~~~~~~~~~~~~~~~~p~~~vTV~DAIsDLP~i~~g~~~~~~~y~~~p~s~yq~~ 801 (1002)
T 3swr_A 722 PGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQ 801 (1002)
T ss_dssp TTSCCCCCCCCCBCCCGGGCCCCEEETTEEECCSCCCSSCCSBCCCCHHHHHTTSCCCCTTCCCSEECCCSCCCSHHHHH
T ss_pred CCCCCCCCCCccccccccccccccccccccccccccccccCCcCCcCHHHHhhhCCccccCccccccccCCCCccHHHHH
Confidence 99999999999999888888888888888888777777777888999999999999999999988999999999999999
Q ss_pred HHhccCC
Q psy13720 479 KVWKCYS 485 (487)
Q Consensus 479 ~r~~~~~ 485 (487)
||+..++
T Consensus 802 mR~~~~~ 808 (1002)
T 3swr_A 802 LRGAQYQ 808 (1002)
T ss_dssp HHTTCSS
T ss_pred hhccccc
Confidence 9986553
|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* | Back alignment and structure |
|---|
| >1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 487 | ||||
| d1g55a_ | 343 | c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: | 7e-18 | |
| d2c7pa1 | 327 | c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilu | 2e-16 | |
| d1dcta_ | 324 | c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus a | 3e-15 |
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: C5 cytosine-specific DNA methylase, DCM domain: DNMT2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 82.4 bits (202), Expect = 7e-18
Identities = 52/268 (19%), Positives = 96/268 (35%), Gaps = 28/268 (10%)
Query: 217 PLRCLEVFAGAGGLSRGLDKSGV-ARSTWAIEFDSAAATAFKMNNPGCTVFVDDCNKILQ 275
PLR LE+++G GG+ L +S + A+ AI+ ++ A +K N P + I
Sbjct: 2 PLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITL 61
Query: 276 RVIDNEVCDDKKQKLPRKGEVEMLCGGPPCQGFSGMNRFNQRQYSAFKNSLIVSYLSYCD 335
D + +M+ PPCQ F+ + R S + L + +
Sbjct: 62 EEFD-------------RLSFDMILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRL 108
Query: 336 YYRPRFFLLENVRNFVAFKNSMVLKMTMRCLTQIGYQCTFGTLQAGHFGVSQTRRRAIVL 395
P++ LLENV+ F +L T+ G+Q L G+ +R R ++
Sbjct: 109 QKLPKYILLENVKGFEVSSTRDLLIQTIEN---CGFQYQEFLLSPTSLGIPNSRLRYFLI 165
Query: 396 AAAPGEVLPKYPEPWTVFSPRTSQLNVTISKKTYVSTCKWTQSAPYRTITVRDVMSDLPE 455
A E LP + +++ K Q + ++D + D +
Sbjct: 166 AKLQSEPLPFQAPGQVLMEFPKIEIH-----------RKNQQDSDLSVKMLKDFLEDDTD 214
Query: 456 IQNGCKMEELPYKENALSHFQREKVWKC 483
+ + + L + +
Sbjct: 215 VNQYLLPPKSLLRYALLLDIVQPTCRRS 242
|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Length = 324 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 487 | |||
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 100.0 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 100.0 | |
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1m4za_ | 217 | Origin-recognition complex protein 120kDa subunit, | 99.52 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 98.27 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 98.18 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 98.0 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 97.99 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 97.98 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 97.97 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 97.95 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 97.94 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 97.79 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 97.74 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 97.58 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 97.49 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 97.23 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 97.21 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 97.11 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 96.91 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 96.43 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 95.88 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 95.31 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 95.27 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 94.92 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 94.67 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 94.63 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 94.58 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 94.55 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 94.54 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 94.46 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 94.35 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 93.94 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 93.68 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 93.68 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 93.51 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 93.5 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 93.35 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 93.3 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 93.01 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 92.91 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 92.47 | |
| d1sqga2 | 284 | Ribosomal RNA small subunit methyltransferase B, R | 92.36 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 92.27 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 92.26 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 91.94 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 91.77 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 91.71 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 91.46 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 91.4 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 91.31 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 91.16 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 91.08 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 90.76 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 90.56 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 90.5 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 89.41 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 89.24 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 88.85 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 88.53 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 87.66 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 87.45 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 87.33 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 85.66 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 85.54 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 85.44 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 85.32 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 84.33 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 82.61 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 82.45 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 81.63 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 80.97 |
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: C5 cytosine-specific DNA methylase, DCM domain: DNA methylase HaeIII species: Haemophilus aegyptius [TaxId: 197575]
Probab=100.00 E-value=1.2e-45 Score=368.54 Aligned_cols=168 Identities=27% Similarity=0.516 Sum_probs=152.9
Q ss_pred CeEeecccCchHHHHHHhhcCCCcEEEEEcCcHHHHHHHHHhCCCCceeccchHHHHHHhhchhhhccccccCCCCCccc
Q psy13720 218 LRCLEVFAGAGGLSRGLDKSGVARSTWAIEFDSAAATAFKMNNPGCTVFVDDCNKILQRVIDNEVCDDKKQKLPRKGEVE 297 (487)
Q Consensus 218 l~~ldLFsG~Gg~s~Gl~~aG~~~~~~a~e~~~~a~~t~~~N~p~~~~~~~di~~~~~~~~~~~~~~~~~~~~p~~~~vd 297 (487)
|+++||||||||+++||++||+ ++++|+|+|+.|++||++|||+ .++.+||.++ ....+| ++|
T Consensus 1 mk~~~lF~G~Gg~~~gl~~aG~-~~~~a~e~d~~a~~~~~~N~~~-~~~~~Di~~~------------~~~~~~---~~d 63 (324)
T d1dcta_ 1 MNLISLFSGAGGLDLGFQKAGF-RIICANEYDKSIWKTYESNHSA-KLIKGDISKI------------SSDEFP---KCD 63 (324)
T ss_dssp CEEEEESCSSCHHHHHHHHHTC-EEEEEEECCHHHHHHHHHHCCS-EEEESCTTTS------------CGGGSC---CCS
T ss_pred CeEEEeCcCcCHHHHHHHHCCC-EEEEEEeCCHHHHHHHHHHCCC-CCccCChhhC------------CHhHcc---ccc
Confidence 6899999999999999999998 9999999999999999999986 4566787754 223344 799
Q ss_pred EEEccCCCcCcccCCccCCcccccchhHHHHHHHHHhhhcCCcEEEEecCcchhcccchhHHHHHHHHHHhCCCeeEEEE
Q psy13720 298 MLCGGPPCQGFSGMNRFNQRQYSAFKNSLIVSYLSYCDYYRPRFFLLENVRNFVAFKNSMVLKMTMRCLTQIGYQCTFGT 377 (487)
Q Consensus 298 ~i~ggpPCq~fS~~~~~~~~~~~d~r~~L~~~~l~~v~~~~P~~~ilENV~gl~~~~~~~~~~~i~~~l~~~GY~~~~~~ 377 (487)
+|+||||||+||.+|+. .+.+|.|+.|+.+++++|+.++|++|+||||+||++.+.+..+..++..|.++||.+.+.+
T Consensus 64 ll~~g~PCq~fS~ag~~--~g~~d~r~~l~~~~~~~i~~~~Pk~~~lENV~~~~~~~~~~~~~~~l~~l~~lGY~v~~~v 141 (324)
T d1dcta_ 64 GIIGGPPCQSWSEGGSL--RGIDDPRGKLFYEYIRILKQKKPIFFLAENVKGMMAQRHNKAVQEFIQEFDNAGYDVHIIL 141 (324)
T ss_dssp EEEECCCCTTTSSSSCC--CCSSSHHHHHHHHHHHHHHHHCCSEEEEEEEGGGGSGGGHHHHHHHHHHHHHHHEEEEEEE
T ss_pred EEeeccccccccccccc--ccccccccchHHHHHHHHHhhCCceeeccccccccccccchhhHHHHhHHhhCCCccceee
Confidence 99999999999999974 4467899999999999999999999999999999999999999999999999999999999
Q ss_pred EeccCCCCCCcccEEEEEEEcCCCCCC
Q psy13720 378 LQAGHFGVSQTRRRAIVLAAAPGEVLP 404 (487)
Q Consensus 378 l~a~~yGvPQ~R~R~fiia~~~~~~~p 404 (487)
|||++||+||+|+|+||||.+++...+
T Consensus 142 lna~~~GvPQ~R~R~fiv~~r~~~~~~ 168 (324)
T d1dcta_ 142 LNANDYGVAQDRKRVFYIGFRKELNIN 168 (324)
T ss_dssp EEGGGGTCSBCCEEEEEEEEEGGGCCC
T ss_pred eecccccCchhhceeeEeeecCCCCcc
Confidence 999999999999999999999886654
|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|