Diaphorina citri psyllid: psy13740


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MNHFLISFSYQDVRAPNRSHFHSFVYFYFSQKDTPQGTLMTDLPVAIKKVDMTKKMQTYVIRAAKVAFEKCTSQEEIAAYLKNRFNRRFEPMWTCIVGTNFGAYVSYESRRFIYFYLGQTGVLLFRNGSILHDIQMYLKSSAEAKAKGPRKRKLRPDCKFALAGGPKKEKDEKKEDEEEEEEEKE
ccEEEEEEEECccccccccccccEEEEEECcccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccEEEEEEccccEEEEEEcccEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHcccccccccccccEEcccccccccccccccHHHHHHHHc
*NHFLISFSYQDVRAPNRSHFHSFVYFYFSQKDT***TLMTDLPVAIKKVDMTKKMQTYVIRAAKVAFEKCTSQEEIAAYLKNRFNRRFEPMWTCIVGTNFGAYVSYESRRFIYFYLGQTGVLLFRNGSILHDIQMYL*******************CK**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNHFLISFSYQDVRAPNRSHFHSFVYFYFSQKDTPQGTLMTDLPVAIKKVDMTKKMQTYVIRAAKVAFEKCTSQEEIAAYLKNRFNRRFEPMWTCIVGTNFGAYVSYESRRFIYFYLGQTGVLLFRNGSILHDIQMYLKSSAEAKAKGPRKRKLRPDCKFALAGGPKKEKDEKKEDEEEEEEEKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynein light chain 1, cytoplasmic Acts as one of several non-catalytic accessory components of the cytoplasmic dynein complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.confidentQ9UR05

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030286 [CC]dynein complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YO3, chain A
Confidence level:very confident
Coverage over the Query: 44-128
View the alignment between query and template
View the model in PyMOL