Psyllid ID: psy13748
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 296 | ||||||
| 110456486 | 186 | glutathione S-transferase-like protein [ | 0.472 | 0.752 | 0.992 | 8e-75 | |
| 373940153 | 218 | glutathione S-transferase E1 [Laodelphax | 0.479 | 0.651 | 0.486 | 9e-36 | |
| 387413675 | 218 | glutathione s-transferase E1 [Sogatella | 0.5 | 0.678 | 0.479 | 2e-35 | |
| 387413335 | 217 | glutathione s-transferase E1 [Nilaparvat | 0.496 | 0.677 | 0.493 | 2e-34 | |
| 91076566 | 216 | PREDICTED: similar to Glutathione S tran | 0.489 | 0.671 | 0.5 | 3e-34 | |
| 169234678 | 217 | glutathione S-transferase epsilon 4 [Bom | 0.479 | 0.654 | 0.486 | 7e-33 | |
| 387413647 | 220 | glutathione s-transferase D1 [Sogatella | 0.527 | 0.709 | 0.435 | 8e-33 | |
| 195384569 | 221 | GJ19893 [Drosophila virilis] gi|19414578 | 0.381 | 0.511 | 0.634 | 1e-32 | |
| 373940163 | 220 | glutathione S-transferase D1 [Laodelphax | 0.527 | 0.709 | 0.423 | 2e-32 | |
| 91085767 | 220 | PREDICTED: similar to GST [Tribolium cas | 0.483 | 0.65 | 0.482 | 2e-32 |
| >gi|110456486|gb|ABG74715.1| glutathione S-transferase-like protein [Diaphorina citri] | Back alignment and taxonomy information |
|---|
Score = 286 bits (732), Expect = 8e-75, Method: Compositional matrix adjust.
Identities = 139/140 (99%), Positives = 140/140 (100%)
Query: 135 QLNPQHTVPTLEDGDLIVWDSHAINAYLVSAYGKNDALYPKDPKVRALVDQRLHFDSGVL 194
+LNPQHTVPTLEDGDLIVWDSHAINAYLVSAYGKNDALYPKDPKVRALVDQRLHFDSGVL
Sbjct: 47 KLNPQHTVPTLEDGDLIVWDSHAINAYLVSAYGKNDALYPKDPKVRALVDQRLHFDSGVL 106
Query: 195 FSALRNIGLKIFFKNEKEIPEEDKLRAREALDFAEKFLQGRKFITGDTYNIADFSIYTTA 254
FSALRNIGLKIFFKNEKEIPEEDKLRAREALDFAEKFLQGRKFITGDTYNIADFSIYTTA
Sbjct: 107 FSALRNIGLKIFFKNEKEIPEEDKLRAREALDFAEKFLQGRKFITGDTYNIADFSIYTTA 166
Query: 255 SALVALVPGLEKYPNLAKYF 274
SALVALVPGLEKYPNLAKYF
Sbjct: 167 SALVALVPGLEKYPNLAKYF 186
|
Source: Diaphorina citri Species: Diaphorina citri Genus: Diaphorina Family: Psyllidae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|373940153|gb|AEY80029.1| glutathione S-transferase E1 [Laodelphax striatella] | Back alignment and taxonomy information |
|---|
| >gi|387413675|gb|AFJ75817.1| glutathione s-transferase E1 [Sogatella furcifera] | Back alignment and taxonomy information |
|---|
| >gi|387413335|gb|AFJ75805.1| glutathione s-transferase E1 [Nilaparvata lugens] | Back alignment and taxonomy information |
|---|
| >gi|91076566|ref|XP_967147.1| PREDICTED: similar to Glutathione S transferase E6 CG17530-PA [Tribolium castaneum] gi|270002389|gb|EEZ98836.1| hypothetical protein TcasGA2_TC004445 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|169234678|ref|NP_001108460.1| glutathione S-transferase epsilon 4 [Bombyx mori] gi|154000792|gb|ABS56977.1| glutathione S-transferase 9 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|387413647|gb|AFJ75816.1| glutathione s-transferase D1 [Sogatella furcifera] | Back alignment and taxonomy information |
|---|
| >gi|195384569|ref|XP_002050987.1| GJ19893 [Drosophila virilis] gi|194145784|gb|EDW62180.1| GJ19893 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|373940163|gb|AEY80034.1| glutathione S-transferase D1 [Laodelphax striatella] | Back alignment and taxonomy information |
|---|
| >gi|91085767|ref|XP_974204.1| PREDICTED: similar to GST [Tribolium castaneum] gi|270010123|gb|EFA06571.1| hypothetical protein TcasGA2_TC009482 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 296 | ||||||
| FB|FBgn0063493 | 229 | GstE7 "Glutathione S transfera | 0.486 | 0.628 | 0.530 | 2.5e-33 | |
| FB|FBgn0063494 | 231 | GstE6 "Glutathione S transfera | 0.462 | 0.593 | 0.496 | 9.8e-32 | |
| FB|FBgn0063492 | 223 | GstE8 "Glutathione S transfera | 0.462 | 0.614 | 0.532 | 2e-31 | |
| FB|FBgn0063491 | 221 | GstE9 "Glutathione S transfera | 0.469 | 0.628 | 0.489 | 5.4e-31 | |
| FB|FBgn0063495 | 226 | GstE5 "Glutathione S transfera | 0.462 | 0.606 | 0.489 | 2.7e-29 | |
| FB|FBgn0063498 | 221 | GstE2 "Glutathione S transfera | 0.381 | 0.511 | 0.548 | 3.4e-29 | |
| FB|FBgn0063499 | 240 | GstE10 "Glutathione S transfer | 0.462 | 0.570 | 0.457 | 1.2e-28 | |
| FB|FBgn0063496 | 222 | GstE4 "Glutathione S transfera | 0.496 | 0.662 | 0.46 | 1.2e-28 | |
| FB|FBgn0063497 | 220 | GstE3 "Glutathione S transfera | 0.381 | 0.513 | 0.570 | 1.5e-28 | |
| FB|FBgn0034335 | 224 | GstE1 "Glutathione S transfera | 0.391 | 0.517 | 0.533 | 6.4e-28 |
| FB|FBgn0063493 GstE7 "Glutathione S transferase E7" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 363 (132.8 bits), Expect = 2.5e-33, P = 2.5e-33
Identities = 79/149 (53%), Positives = 97/149 (65%)
Query: 131 NFSPQL---NPQHTVPTLEDGDLIVWDSHAINAYLVSAYGKNDALYPKDPKVRALVDQRL 187
NFS + NPQHTVPTLED +WDSHAI AYLVS YGK D+LYPKD RA+VDQRL
Sbjct: 47 NFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRL 106
Query: 188 HFDSGVLFS-ALRNIGLKIFFKNEKEIPEEDKLRAREALDFAEKFLQGRKFITGDTYNIA 246
HF+SGV+F+ ALR+I +F + IP+E E DF EKFL G ++ G+ IA
Sbjct: 107 HFESGVIFANALRSITKPLFAGKQTMIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIA 166
Query: 247 DFSIYTTASALVALVP-GLEKYPNLAKYF 274
DFSI +T S+L V KYP +A +F
Sbjct: 167 DFSIISTVSSLEVFVKVDTTKYPRIAAWF 195
|
|
| FB|FBgn0063494 GstE6 "Glutathione S transferase E6" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0063492 GstE8 "Glutathione S transferase E8" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0063491 GstE9 "Glutathione S transferase E9" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0063495 GstE5 "Glutathione S transferase E5" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0063498 GstE2 "Glutathione S transferase E2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0063499 GstE10 "Glutathione S transferase E10" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0063496 GstE4 "Glutathione S transferase E4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0063497 GstE3 "Glutathione S transferase E3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034335 GstE1 "Glutathione S transferase E1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 296 | |||
| cd03177 | 117 | cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he | 4e-33 | |
| cd03045 | 74 | cd03045, GST_N_Delta_Epsilon, GST_N family, Class | 4e-31 | |
| COG0625 | 211 | COG0625, Gst, Glutathione S-transferase [Posttrans | 2e-20 | |
| cd00570 | 71 | cd00570, GST_N_family, Glutathione S-transferase ( | 2e-16 | |
| COG0625 | 211 | COG0625, Gst, Glutathione S-transferase [Posttrans | 8e-16 | |
| cd03053 | 76 | cd03053, GST_N_Phi, GST_N family, Class Phi subfam | 7e-13 | |
| cd03050 | 76 | cd03050, GST_N_Theta, GST_N family, Class Theta su | 7e-13 | |
| cd03045 | 74 | cd03045, GST_N_Delta_Epsilon, GST_N family, Class | 9e-13 | |
| cd03046 | 76 | cd03046, GST_N_GTT1_like, GST_N family, Saccharomy | 5e-12 | |
| cd03047 | 73 | cd03047, GST_N_2, GST_N family, unknown subfamily | 6e-12 | |
| cd03042 | 73 | cd03042, GST_N_Zeta, GST_N family, Class Zeta subf | 7e-12 | |
| pfam13417 | 75 | pfam13417, GST_N_3, Glutathione S-transferase, N-t | 2e-11 | |
| cd03048 | 81 | cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik | 5e-11 | |
| TIGR01262 | 210 | TIGR01262, maiA, maleylacetoacetate isomerase | 1e-10 | |
| PRK15113 | 214 | PRK15113, PRK15113, glutathione S-transferase; Pro | 5e-10 | |
| cd03056 | 73 | cd03056, GST_N_4, GST_N family, unknown subfamily | 6e-09 | |
| pfam13409 | 68 | pfam13409, GST_N_2, Glutathione S-transferase, N-t | 7e-09 | |
| cd03051 | 74 | cd03051, GST_N_GTT2_like, GST_N family, Saccharomy | 1e-08 | |
| cd00299 | 100 | cd00299, GST_C_family, C-terminal, alpha helical d | 5e-08 | |
| cd03178 | 110 | cd03178, GST_C_Ure2p_like, C-terminal, alpha helic | 7e-08 | |
| PLN02395 | 215 | PLN02395, PLN02395, glutathione S-transferase | 1e-07 | |
| cd03057 | 77 | cd03057, GST_N_Beta, GST_N family, Class Beta subf | 2e-07 | |
| cd03047 | 73 | cd03047, GST_N_2, GST_N family, unknown subfamily | 3e-07 | |
| cd03177 | 117 | cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he | 4e-07 | |
| PLN02395 | 215 | PLN02395, PLN02395, glutathione S-transferase | 5e-07 | |
| PLN02473 | 214 | PLN02473, PLN02473, glutathione S-transferase | 6e-07 | |
| PLN02473 | 214 | PLN02473, PLN02473, glutathione S-transferase | 7e-07 | |
| pfam00043 | 92 | pfam00043, GST_C, Glutathione S-transferase, C-ter | 8e-07 | |
| cd00570 | 71 | cd00570, GST_N_family, Glutathione S-transferase ( | 2e-06 | |
| TIGR01262 | 210 | TIGR01262, maiA, maleylacetoacetate isomerase | 2e-06 | |
| pfam02798 | 74 | pfam02798, GST_N, Glutathione S-transferase, N-ter | 2e-06 | |
| pfam13410 | 69 | pfam13410, GST_C_2, Glutathione S-transferase, C-t | 6e-06 | |
| cd10291 | 110 | cd10291, GST_C_YfcG_like, C-terminal, alpha helica | 7e-06 | |
| cd03182 | 116 | cd03182, GST_C_GTT2_like, C-terminal, alpha helica | 2e-05 | |
| cd03183 | 126 | cd03183, GST_C_Theta, C-terminal, alpha helical do | 3e-05 | |
| cd03046 | 76 | cd03046, GST_N_GTT1_like, GST_N family, Saccharomy | 4e-05 | |
| cd03043 | 73 | cd03043, GST_N_1, GST_N family, unknown subfamily | 8e-05 | |
| cd03059 | 73 | cd03059, GST_N_SspA, GST_N family, Stringent starv | 2e-04 | |
| PRK15113 | 214 | PRK15113, PRK15113, glutathione S-transferase; Pro | 3e-04 | |
| pfam13417 | 75 | pfam13417, GST_N_3, Glutathione S-transferase, N-t | 4e-04 | |
| PRK10357 | 202 | PRK10357, PRK10357, putative glutathione S-transfe | 0.001 | |
| PRK09481 | 211 | PRK09481, sspA, stringent starvation protein A; Pr | 0.001 | |
| cd03189 | 123 | cd03189, GST_C_GTT1_like, C-terminal, alpha helica | 0.001 | |
| cd03050 | 76 | cd03050, GST_N_Theta, GST_N family, Class Theta su | 0.002 | |
| cd03043 | 73 | cd03043, GST_N_1, GST_N family, unknown subfamily | 0.002 | |
| cd03181 | 123 | cd03181, GST_C_EF1Bgamma_like, Glutathione S-trans | 0.002 | |
| cd03042 | 73 | cd03042, GST_N_Zeta, GST_N family, Class Zeta subf | 0.003 | |
| cd03059 | 73 | cd03059, GST_N_SspA, GST_N family, Stringent starv | 0.003 | |
| cd10305 | 101 | cd10305, GST_C_AIMP3, Glutathione S-transferase C- | 0.003 | |
| cd03207 | 101 | cd03207, GST_C_8, C-terminal, alpha helical domain | 0.003 | |
| cd03052 | 73 | cd03052, GST_N_GDAP1, GST_N family, Ganglioside-in | 0.003 | |
| cd03206 | 100 | cd03206, GST_C_7, C-terminal, alpha helical domain | 0.004 |
| >gnl|CDD|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases | Back alignment and domain information |
|---|
Score = 117 bits (296), Expect = 4e-33
Identities = 47/113 (41%), Positives = 64/113 (56%), Gaps = 1/113 (0%)
Query: 178 KVRALVDQRLHFDSGVLFSALRNIGLKIFFKNEKEIPEEDKLRAREALDFAEKFLQGRKF 237
K RA+V+QRL FDSG L+ LR+ I F E PEE + EAL+F E FL+G +
Sbjct: 1 KKRAIVNQRLFFDSGTLYQRLRDYYYPILFGG-AEPPEEKLDKLEEALEFLETFLEGSDY 59
Query: 238 ITGDTYNIADFSIYTTASALVALVPGLEKYPNLAKYFDLCKSSFKGISHDEEG 290
+ GD IAD S+ T S L + L KYPN+A +++ K+ G + EG
Sbjct: 60 VAGDQLTIADLSLVATVSTLEVVGFDLSKYPNVAAWYERLKALPPGEEENGEG 112
|
Glutathione S-transferase (GST) C-terminal domain family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Delta and Epsilon subfamily is made up primarily of insect GSTs, which play major roles in insecticide resistance by facilitating reductive dehydrochlorination of insecticides or conjugating them with GSH to produce water-soluble metabolites that are easily excreted. They are also implicated in protection against cellular damage by oxidative stress. Length = 117 |
| >gnl|CDD|239343 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >gnl|CDD|239343 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|198288 cd03178, GST_C_Ure2p_like, C-terminal, alpha helical domain of Ure2p and related Glutathione S-transferase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase | Back alignment and domain information |
|---|
| >gnl|CDD|239355 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase | Back alignment and domain information |
|---|
| >gnl|CDD|166114 PLN02473, PLN02473, glutathione S-transferase | Back alignment and domain information |
|---|
| >gnl|CDD|166114 PLN02473, PLN02473, glutathione S-transferase | Back alignment and domain information |
|---|
| >gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|198324 cd10291, GST_C_YfcG_like, C-terminal, alpha helical domain of Escherichia coli YfcG Glutathione S-transferases and related uncharacterized proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198291 cd03182, GST_C_GTT2_like, C-terminal, alpha helical domain of GTT2-like Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|198292 cd03183, GST_C_Theta, C-terminal, alpha helical domain of Class Theta Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|239341 cd03043, GST_N_1, GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239357 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|182405 PRK10357, PRK10357, putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236537 PRK09481, sspA, stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198298 cd03189, GST_C_GTT1_like, C-terminal, alpha helical domain of GTT1-like Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >gnl|CDD|239341 cd03043, GST_N_1, GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|198290 cd03181, GST_C_EF1Bgamma_like, Glutathione S-transferase C-terminal-like, alpha helical domain of the Gamma subunit of Elongation Factor 1B and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239357 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >gnl|CDD|198338 cd10305, GST_C_AIMP3, Glutathione S-transferase C-terminal-like, alpha helical domain of Aminoacyl tRNA synthetase complex-Interacting Multifunctional Protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|198316 cd03207, GST_C_8, C-terminal, alpha helical domain of an unknown subfamily 8 of Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|239350 cd03052, GST_N_GDAP1, GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >gnl|CDD|198315 cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 100.0 | |
| PLN02473 | 214 | glutathione S-transferase | 100.0 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 100.0 | |
| PLN02395 | 215 | glutathione S-transferase | 99.97 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 99.97 | |
| KOG0406|consensus | 231 | 99.97 | ||
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 99.97 | |
| KOG0867|consensus | 226 | 99.97 | ||
| KOG0868|consensus | 217 | 99.97 | ||
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 99.97 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 99.97 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 99.96 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 99.96 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 99.95 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 99.94 | |
| KOG4420|consensus | 325 | 99.94 | ||
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 99.93 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 99.93 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 99.92 | |
| KOG1695|consensus | 206 | 99.91 | ||
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 99.91 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 99.81 | |
| PLN02907 | 722 | glutamate-tRNA ligase | 99.81 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 99.79 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 99.79 | |
| KOG1422|consensus | 221 | 99.78 | ||
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 99.78 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 99.78 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 99.77 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 99.76 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 99.76 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 99.75 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 99.74 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 99.74 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 99.74 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 99.73 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 99.73 | |
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 99.73 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 99.73 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 99.73 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 99.72 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 99.72 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 99.7 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 99.69 | |
| KOG4244|consensus | 281 | 99.68 | ||
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 99.68 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 99.68 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 99.68 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 99.66 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 99.66 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 99.66 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 99.65 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 99.65 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 99.64 | |
| KOG3029|consensus | 370 | 99.63 | ||
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 99.59 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 99.55 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 99.55 | |
| COG0435 | 324 | ECM4 Predicted glutathione S-transferase [Posttran | 99.55 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 99.52 | |
| KOG2903|consensus | 319 | 99.51 | ||
| KOG0868|consensus | 217 | 99.47 | ||
| KOG3027|consensus | 257 | 99.47 | ||
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 99.45 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 99.43 | |
| cd03196 | 115 | GST_C_5 GST_C family, unknown subfamily 5; compose | 99.38 | |
| cd03177 | 118 | GST_C_Delta_Epsilon GST_C family, Class Delta and | 99.37 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 99.37 | |
| cd03189 | 119 | GST_C_GTT1_like GST_C family, Saccharomyces cerevi | 99.33 | |
| cd03188 | 114 | GST_C_Beta GST_C family, Class Beta subfamily; GST | 99.31 | |
| cd03186 | 107 | GST_C_SspA GST_N family, Stringent starvation prot | 99.3 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 99.29 | |
| cd03180 | 110 | GST_C_2 GST_C family, unknown subfamily 2; compose | 99.28 | |
| cd03182 | 117 | GST_C_GTT2_like GST_C family, Saccharomyces cerevi | 99.26 | |
| cd03191 | 121 | GST_C_Zeta GST_C family, Class Zeta subfamily; GST | 99.25 | |
| cd03178 | 113 | GST_C_Ure2p_like GST_C family, Ure2p-like subfamil | 99.25 | |
| cd03190 | 142 | GST_C_ECM4_like GST_C family, ECM4-like subfamily; | 99.2 | |
| KOG0406|consensus | 231 | 99.2 | ||
| cd03185 | 126 | GST_C_Tau GST_C family, Class Tau subfamily; GSTs | 99.19 | |
| cd03187 | 118 | GST_C_Phi GST_C family, Class Phi subfamily; compo | 99.16 | |
| cd03198 | 134 | GST_C_CLIC GST_C family, Chloride Intracellular Ch | 99.13 | |
| cd03200 | 96 | GST_C_JTV1 GST_C family, JTV-1 subfamily; composed | 99.11 | |
| cd03203 | 120 | GST_C_Lambda GST_C family, Class Lambda subfamily; | 99.1 | |
| cd03206 | 100 | GST_C_7 GST_C family, unknown subfamily 7; compose | 99.09 | |
| cd03181 | 123 | GST_C_EFB1gamma GST_C family, Gamma subunit of Elo | 99.09 | |
| cd03195 | 114 | GST_C_4 GST_C family, unknown subfamily 4; compose | 99.08 | |
| cd03184 | 124 | GST_C_Omega GST_C family, Class Omega subfamily; G | 99.08 | |
| cd03207 | 103 | GST_C_8 GST_C family, unknown subfamily 8; compose | 99.07 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 99.04 | |
| PF00043 | 95 | GST_C: Glutathione S-transferase, C-terminal domai | 99.02 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 99.02 | |
| cd03183 | 126 | GST_C_Theta GST_C family, Class Theta subfamily; c | 99.01 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 99.0 | |
| cd03179 | 105 | GST_C_1 GST_C family, unknown subfamily 1; compose | 98.99 | |
| cd03209 | 121 | GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar | 98.99 | |
| cd03204 | 111 | GST_C_GDAP1 GST_C family, Ganglioside-induced diff | 98.97 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 98.96 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 98.95 | |
| cd03201 | 121 | GST_C_DHAR GST_C family, Dehydroascorbate Reductas | 98.94 | |
| KOG0867|consensus | 226 | 98.9 | ||
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 98.89 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 98.87 | |
| PLN02395 | 215 | glutathione S-transferase | 98.85 | |
| cd03210 | 126 | GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar | 98.85 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 98.84 | |
| PLN02473 | 214 | glutathione S-transferase | 98.84 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 98.84 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 98.82 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 98.82 | |
| cd03208 | 137 | GST_C_Alpha GST_C family, Class Alpha subfamily; G | 98.81 | |
| KOG3028|consensus | 313 | 98.8 | ||
| cd03194 | 114 | GST_C_3 GST_C family, unknown subfamily 3; compose | 98.8 | |
| PF13410 | 69 | GST_C_2: Glutathione S-transferase, C-terminal dom | 98.79 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 98.77 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 98.76 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 98.75 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 98.74 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 98.73 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 98.72 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 98.72 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 98.71 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 98.7 | |
| PF14497 | 99 | GST_C_3: Glutathione S-transferase, C-terminal dom | 98.69 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 98.67 | |
| cd00299 | 100 | GST_C_family Glutathione S-transferase (GST) famil | 98.66 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 98.65 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 98.65 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 98.64 | |
| cd03197 | 149 | GST_C_mPGES2 GST_C family; microsomal Prostaglandi | 98.64 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 98.64 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 98.63 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 98.63 | |
| cd03202 | 124 | GST_C_etherase_LigE GST_C family, Beta etherase Li | 98.63 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 98.62 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 98.61 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 98.6 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 98.6 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 98.59 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 98.59 | |
| cd03192 | 104 | GST_C_Sigma_like GST_C family, Class Sigma_like; c | 98.59 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 98.57 | |
| cd03193 | 88 | GST_C_Metaxin GST_C family, Metaxin subfamily; com | 98.56 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 98.53 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 98.5 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 98.5 | |
| PLN02907 | 722 | glutamate-tRNA ligase | 98.5 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 98.49 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 98.47 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 98.46 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 98.46 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 98.45 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 98.43 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 98.43 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 98.42 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 98.41 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 98.41 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 98.4 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 98.39 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 98.38 | |
| cd03211 | 126 | GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me | 98.37 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 98.33 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 98.33 | |
| cd03212 | 137 | GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, | 98.32 | |
| KOG1695|consensus | 206 | 98.3 | ||
| PF14834 | 117 | GST_C_4: Glutathione S-transferase, C-terminal dom | 98.29 | |
| cd03205 | 98 | GST_C_6 GST_C family, unknown subfamily 6; compose | 98.25 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 98.25 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 98.24 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 98.22 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 98.2 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 98.18 | |
| KOG4420|consensus | 325 | 98.16 | ||
| PRK10387 | 210 | glutaredoxin 2; Provisional | 98.16 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 98.12 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 98.06 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 97.99 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 97.96 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 97.89 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 97.89 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 97.87 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 97.85 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 97.84 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 97.81 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 97.56 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 97.4 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 97.33 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 96.86 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 96.84 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 96.81 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 96.78 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 96.77 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 96.74 | |
| KOG1752|consensus | 104 | 96.68 | ||
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 96.64 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 96.6 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 96.55 | |
| KOG1422|consensus | 221 | 96.44 | ||
| PRK10026 | 141 | arsenate reductase; Provisional | 96.44 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 96.42 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 96.4 | |
| cd03199 | 128 | GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub | 96.4 | |
| PF04399 | 132 | Glutaredoxin2_C: Glutaredoxin 2, C terminal domain | 96.32 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 96.18 | |
| COG4545 | 85 | Glutaredoxin-related protein [Posttranslational mo | 96.15 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 96.11 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 96.04 | |
| PRK10853 | 118 | putative reductase; Provisional | 95.94 | |
| cd03030 | 92 | GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 | 95.7 | |
| PF04908 | 99 | SH3BGR: SH3-binding, glutamic acid-rich protein; I | 95.67 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 95.31 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 95.18 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 95.16 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 94.77 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 94.69 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 94.57 | |
| KOG1147|consensus | 712 | 94.33 | ||
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 93.6 | |
| PHA02125 | 75 | thioredoxin-like protein | 93.43 | |
| PF11287 | 112 | DUF3088: Protein of unknown function (DUF3088); In | 92.97 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 92.95 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 92.5 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 92.41 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 91.73 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 89.48 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 88.34 | |
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 86.6 |
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.7e-33 Score=226.63 Aligned_cols=186 Identities=18% Similarity=0.250 Sum_probs=152.0
Q ss_pred cEEEecCCCchhHHHHHHHHHhCCceeEEEecccccccchHHHHhhCCCccccEEeeCCeeeeecHHHHHHHHHhcCCCC
Q psy13748 3 LILHEIIASPPVRAVKLCLTELGLEAEYKTCNLLAREQFSDEYLKLNPQHTVPTLEDGDLIVWDSHAINAYLVSAYGKND 82 (296)
Q Consensus 3 ~~Ly~~~~s~~~~~v~~~L~~~gi~~~~~~i~~~~~~~~~~~~~~~~p~~~vP~l~~~~~~~~es~~I~~yl~~~~~~~~ 82 (296)
++||+++.|++|++|+++|+++|++|+.+.++. ++.+++|+++||.|+||+|++||.+|+||.+|++||+++++. .
T Consensus 11 ~~Ly~~~~s~~~~rv~~~L~e~gl~~e~~~v~~---~~~~~~~~~~nP~g~VPvL~~~g~~l~ES~AIl~YL~~~~~~-~ 86 (211)
T PRK09481 11 MTLFSGPTDIYSHQVRIVLAEKGVSVEIEQVEK---DNLPQDLIDLNPYQSVPTLVDRELTLYESRIIMEYLDERFPH-P 86 (211)
T ss_pred eEEeCCCCChhHHHHHHHHHHCCCCCEEEeCCc---ccCCHHHHHhCCCCCCCEEEECCEEeeCHHHHHHHHHHhCCC-C
Confidence 899999999999999999999999999999987 345789999999999999999999999999999999999986 3
Q ss_pred CCCCCCHHHHHHHhhhhhccccchhhhhhhhccCcceEeeccCCCCCCccccccCCCCCccEEEeCCEEeeccHHHHHHH
Q psy13748 83 ALYPKDPKVRALVDQRLHFDSGVLFSALRNIGVSKTFCSDLYLGWIPINFSPQLNPQHTVPTLEDGDLIVWDSHAINAYL 162 (296)
Q Consensus 83 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~nP~~~vP~L~~~g~~l~es~aI~~yl 162 (296)
.|+|.++.+|+.++.|+.+..+.+.....
T Consensus 87 ~l~p~~~~~ra~~~~~~~~~~~~~~~~~~--------------------------------------------------- 115 (211)
T PRK09481 87 PLMPVYPVARGESRLMMHRIEKDWYSLMN--------------------------------------------------- 115 (211)
T ss_pred CCCCCCHHHHHHHHHHHHHHHHHHHHHHH---------------------------------------------------
Confidence 68898888888888887654332211000
Q ss_pred HHHhCCCCCCCCCCHHHHHHHHhHHhhccchhhhHHHHhhhhhhccCCcCCcHHHHHHHHHHHHHHHHHcCCCCCcCCCc
Q psy13748 163 VSAYGKNDALYPKDPKVRALVDQRLHFDSGVLFSALRNIGLKIFFKNEKEIPEEDKLRAREALDFAEKFLQGRKFITGDT 242 (296)
Q Consensus 163 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~g~~ 242 (296)
. + . .......+...+.+...+..++++|++++|++|++
T Consensus 116 -------------------------------------~-~---~-~~~~~~~~~~~~~l~~~l~~le~~L~~~~~l~G~~ 153 (211)
T PRK09481 116 -------------------------------------K-I---V-NGSASEADAARKQLREELLAIAPVFGEKPYFMSEE 153 (211)
T ss_pred -------------------------------------H-H---h-cCCHHHHHHHHHHHHHHHHHHHHHhccCCcccCCC
Confidence 0 0 0 00011123445678888899999999889999999
Q ss_pred ccchhHhHHHHHHHHHhhCCCC--CCchhHHHHHHHHhccccCccc
Q psy13748 243 YNIADFSIYTTASALVALVPGL--EKYPNLAKYFDLCKSSFKGISH 286 (296)
Q Consensus 243 ~t~aD~~~~~~l~~~~~~~~~~--~~~p~l~~~~~~~~~~~p~~~~ 286 (296)
+|+||+.+++.+.+....++++ ..+|+|.+|++++.+ +|++++
T Consensus 154 ~t~AD~~l~~~~~~~~~~~~~~~~~~~p~l~~w~~~~~~-rp~~~~ 198 (211)
T PRK09481 154 FSLVDCYLAPLLWRLPVLGIELSGPGAKELKGYMTRVFE-RDSFLA 198 (211)
T ss_pred ccHHHHHHHHHHHHHHhcCCCCCCCCChhHHHHHHHHhc-cHHHHH
Confidence 9999999999998777666653 579999999999999 999998
|
|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0406|consensus | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0867|consensus | Back alignment and domain information |
|---|
| >KOG0868|consensus | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >KOG4420|consensus | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >KOG1695|consensus | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >KOG1422|consensus | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >KOG4244|consensus | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >KOG3029|consensus | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >KOG2903|consensus | Back alignment and domain information |
|---|
| >KOG0868|consensus | Back alignment and domain information |
|---|
| >KOG3027|consensus | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 | Back alignment and domain information |
|---|
| >KOG0406|consensus | Back alignment and domain information |
|---|
| >cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins | Back alignment and domain information |
|---|
| >cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene | Back alignment and domain information |
|---|
| >cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs | Back alignment and domain information |
|---|
| >cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant | Back alignment and domain information |
|---|
| >KOG0867|consensus | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >KOG3028|consensus | Back alignment and domain information |
|---|
| >cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins | Back alignment and domain information |
|---|
| >KOG1695|consensus | Back alignment and domain information |
|---|
| >PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A | Back alignment and domain information |
|---|
| >cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >KOG4420|consensus | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >KOG1752|consensus | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >KOG1422|consensus | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
| >PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >KOG1147|consensus | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 296 | ||||
| 3vwx_A | 222 | Structural Analysis Of An Epsilon-class Glutathione | 3e-35 | ||
| 4hi7_A | 228 | Crystal Structure Of Glutathione Transferase Homolo | 5e-34 | ||
| 4hi7_A | 228 | Crystal Structure Of Glutathione Transferase Homolo | 5e-31 | ||
| 2il3_A | 221 | Structures Of An Insect Epsilon-Class Glutathione S | 6e-29 | ||
| 2il3_A | 221 | Structures Of An Insect Epsilon-Class Glutathione S | 7e-27 | ||
| 3ay8_A | 216 | Glutathione S-Transferase Unclassified 2 From Bomby | 1e-28 | ||
| 3vk9_A | 216 | Crystal Structure Of Delta-Class Glutathione Transf | 5e-28 | ||
| 1pn9_A | 209 | Crystal Structure Of An Insect Delta-class Glutathi | 6e-28 | ||
| 1jlv_A | 209 | Anopheles Dirus Species B Glutathione S-transferase | 8e-28 | ||
| 1v2a_A | 210 | Glutathione S-transferase 1-6 From Anopheles Dirus | 2e-26 | ||
| 1r5a_A | 218 | Glutathione S-Transferase Length = 218 | 3e-26 | ||
| 1r5a_A | 218 | Glutathione S-Transferase Length = 218 | 2e-24 | ||
| 3ein_A | 209 | Delta Class Gst Length = 209 | 6e-26 | ||
| 3f6f_A | 210 | Crystal Structure Of Glutathione Transferase Dmgstd | 1e-24 | ||
| 3f6f_A | 210 | Crystal Structure Of Glutathione Transferase Dmgstd | 6e-24 | ||
| 1jlw_A | 219 | Anopheles Dirus Species B Glutathione S-Transferase | 2e-22 | ||
| 3g7j_A | 219 | Crystal Structure Of A Genetically Modified Delta C | 4e-22 | ||
| 3f6d_A | 219 | Crystal Structure Of A Genetically Modified Delta C | 1e-21 | ||
| 3f6d_A | 219 | Crystal Structure Of A Genetically Modified Delta C | 2e-21 | ||
| 2c3n_A | 247 | Human Glutathione-S-Transferase T1-1, Apo Form Leng | 5e-11 | ||
| 2c3n_A | 247 | Human Glutathione-S-Transferase T1-1, Apo Form Leng | 5e-09 | ||
| 2c3q_A | 247 | Human Glutathione-S-Transferase T1-1 W234r Mutant, | 5e-11 | ||
| 2c3q_A | 247 | Human Glutathione-S-Transferase T1-1 W234r Mutant, | 5e-09 | ||
| 3qav_A | 243 | Crystal Structure Of A Glutathione S-transferase Fr | 9e-11 | ||
| 3qav_A | 243 | Crystal Structure Of A Glutathione S-transferase Fr | 1e-10 | ||
| 4iel_A | 229 | Crystal Structure Of A Glutathione S-Transferase Fa | 1e-10 | ||
| 4iel_A | 229 | Crystal Structure Of A Glutathione S-Transferase Fa | 2e-08 | ||
| 1ljr_A | 244 | Glutathione Transferase (Hgst T2-2) From Human Leng | 2e-10 | ||
| 1ljr_A | 244 | Glutathione Transferase (Hgst T2-2) From Human Leng | 4e-09 | ||
| 1e6b_A | 221 | Crystal Structure Of A Zeta Class Glutathione S-Tra | 8e-09 | ||
| 1e6b_A | 221 | Crystal Structure Of A Zeta Class Glutathione S-Tra | 1e-04 | ||
| 3m3m_A | 210 | Crystal Structure Of Glutathione S-Transferase From | 6e-07 | ||
| 4eci_A | 244 | Crystal Structure Of Glutathione S-Transferase Prk1 | 2e-06 | ||
| 1axd_A | 209 | Structure Of Glutathione S-transferase-i Bound With | 9e-06 | ||
| 1bye_A | 213 | Glutathione S-Transferase I From Mais In Complex Wi | 1e-05 | ||
| 1aw9_A | 216 | Structure Of Glutathione S-Transferase Iii In Apo F | 1e-05 | ||
| 1fw1_A | 216 | Glutathione Transferase ZetaMALEYLACETOACETATE ISOM | 2e-05 | ||
| 4igj_A | 242 | Crystal Structure Of Maleylacetoacetate Isomerase F | 2e-04 | ||
| 3csi_A | 209 | Crystal Structure Of The Glutathione Transferase Pi | 3e-04 | ||
| 2cz2_A | 223 | Crystal Structure Of Glutathione Transferase Zeta 1 | 3e-04 | ||
| 4gss_A | 209 | Human Glutathione S-Transferase P1-1 Y108f Mutant L | 3e-04 | ||
| 17gs_A | 210 | Glutathione S-Transferase P1-1 Length = 210 | 5e-04 | ||
| 1gnw_A | 211 | Structure Of Glutathione S-Transferase Length = 211 | 5e-04 | ||
| 12gs_A | 210 | Glutathione S-transferase Complexed With S-nonyl-gl | 6e-04 | ||
| 22gs_A | 210 | Human Glutathione S-Transferase P1-1 Y49f Mutant Le | 6e-04 | ||
| 1lbk_A | 208 | Crystal Structure Of A Recombinant Glutathione Tran | 7e-04 | ||
| 4pgt_A | 210 | Crystal Structure Of Hgstp1-1[v104] Complexed With | 7e-04 | ||
| 1gss_A | 209 | Three-Dimensional Structure Of Class Pi Glutathione | 7e-04 | ||
| 2pgt_A | 210 | Crystal Structure Of Human Glutathione S-Transferas | 8e-04 |
| >pdb|3VWX|A Chain A, Structural Analysis Of An Epsilon-class Glutathione S-transferase From Housefly, Musca Domestica Length = 222 | Back alignment and structure |
|
| >pdb|4HI7|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Drosophilia Mojavensis, Target Efi-501819, With Bound Glutathione Length = 228 | Back alignment and structure |
| >pdb|4HI7|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Drosophilia Mojavensis, Target Efi-501819, With Bound Glutathione Length = 228 | Back alignment and structure |
| >pdb|2IL3|A Chain A, Structures Of An Insect Epsilon-Class Glutathione S- Transferase From The Malaria Vector Anopheles Gambiae: Evidence For High Ddt-Detoxifying Activity Length = 221 | Back alignment and structure |
| >pdb|2IL3|A Chain A, Structures Of An Insect Epsilon-Class Glutathione S- Transferase From The Malaria Vector Anopheles Gambiae: Evidence For High Ddt-Detoxifying Activity Length = 221 | Back alignment and structure |
| >pdb|3AY8|A Chain A, Glutathione S-Transferase Unclassified 2 From Bombyx Mori Length = 216 | Back alignment and structure |
| >pdb|3VK9|A Chain A, Crystal Structure Of Delta-Class Glutathione Transferase From Silkmoth Length = 216 | Back alignment and structure |
| >pdb|1PN9|A Chain A, Crystal Structure Of An Insect Delta-class Glutathione S- Transferase From A Ddt-resistant Strain Of The Malaria Vector Anopheles Gambiae Length = 209 | Back alignment and structure |
| >pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutathione S-transferases 1-3 Length = 209 | Back alignment and structure |
| >pdb|1V2A|A Chain A, Glutathione S-transferase 1-6 From Anopheles Dirus Species B Length = 210 | Back alignment and structure |
| >pdb|1R5A|A Chain A, Glutathione S-Transferase Length = 218 | Back alignment and structure |
| >pdb|1R5A|A Chain A, Glutathione S-Transferase Length = 218 | Back alignment and structure |
| >pdb|3EIN|A Chain A, Delta Class Gst Length = 209 | Back alignment and structure |
| >pdb|3F6F|A Chain A, Crystal Structure Of Glutathione Transferase Dmgstd10 From Drosophila Melanogaster Length = 210 | Back alignment and structure |
| >pdb|3F6F|A Chain A, Crystal Structure Of Glutathione Transferase Dmgstd10 From Drosophila Melanogaster Length = 210 | Back alignment and structure |
| >pdb|1JLW|A Chain A, Anopheles Dirus Species B Glutathione S-Transferases 1-4 Length = 219 | Back alignment and structure |
| >pdb|3G7J|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (adgstd4- 4) From Anopheles Dirus, Y119e, In Complex With S-hexyl Glutathione Length = 219 | Back alignment and structure |
| >pdb|3F6D|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (Adgstd4- 4) From Anopheles Dirus, F123a, In Complex With S-Hexyl Glutathione Length = 219 | Back alignment and structure |
| >pdb|3F6D|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (Adgstd4- 4) From Anopheles Dirus, F123a, In Complex With S-Hexyl Glutathione Length = 219 | Back alignment and structure |
| >pdb|2C3N|A Chain A, Human Glutathione-S-Transferase T1-1, Apo Form Length = 247 | Back alignment and structure |
| >pdb|2C3N|A Chain A, Human Glutathione-S-Transferase T1-1, Apo Form Length = 247 | Back alignment and structure |
| >pdb|2C3Q|A Chain A, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex With S-Hexylglutathione Length = 247 | Back alignment and structure |
| >pdb|2C3Q|A Chain A, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex With S-Hexylglutathione Length = 247 | Back alignment and structure |
| >pdb|3QAV|A Chain A, Crystal Structure Of A Glutathione S-transferase From Antarctic Clam Laternula Elliptica Length = 243 | Back alignment and structure |
| >pdb|3QAV|A Chain A, Crystal Structure Of A Glutathione S-transferase From Antarctic Clam Laternula Elliptica Length = 243 | Back alignment and structure |
| >pdb|4IEL|A Chain A, Crystal Structure Of A Glutathione S-Transferase Family Protein From Burkholderia Ambifaria, Target Efi-507141, With Bound Glutathione Length = 229 | Back alignment and structure |
| >pdb|4IEL|A Chain A, Crystal Structure Of A Glutathione S-Transferase Family Protein From Burkholderia Ambifaria, Target Efi-507141, With Bound Glutathione Length = 229 | Back alignment and structure |
| >pdb|1LJR|A Chain A, Glutathione Transferase (Hgst T2-2) From Human Length = 244 | Back alignment and structure |
| >pdb|1LJR|A Chain A, Glutathione Transferase (Hgst T2-2) From Human Length = 244 | Back alignment and structure |
| >pdb|1E6B|A Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana Length = 221 | Back alignment and structure |
| >pdb|1E6B|A Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana Length = 221 | Back alignment and structure |
| >pdb|3M3M|A Chain A, Crystal Structure Of Glutathione S-Transferase From Pseudomonas Fluorescens [pf-5] Length = 210 | Back alignment and structure |
| >pdb|4ECI|A Chain A, Crystal Structure Of Glutathione S-Transferase Prk13972 (Target Efi- 501853) From Pseudomonas Aeruginosa Pacs2 Complexed With Acetate Length = 244 | Back alignment and structure |
| >pdb|1AXD|A Chain A, Structure Of Glutathione S-transferase-i Bound With The Ligand Lactoylglutathione Length = 209 | Back alignment and structure |
| >pdb|1BYE|A Chain A, Glutathione S-Transferase I From Mais In Complex With Atrazine Glutathione Conjugate Length = 213 | Back alignment and structure |
| >pdb|1AW9|A Chain A, Structure Of Glutathione S-Transferase Iii In Apo Form Length = 216 | Back alignment and structure |
| >pdb|1FW1|A Chain A, Glutathione Transferase ZetaMALEYLACETOACETATE ISOMERASE Length = 216 | Back alignment and structure |
| >pdb|4IGJ|A Chain A, Crystal Structure Of Maleylacetoacetate Isomerase From Anaeromyxobacter Dehalogenans 2cp-1, Target Efi-507175 Length = 242 | Back alignment and structure |
| >pdb|3CSI|A Chain A, Crystal Structure Of The Glutathione Transferase Pi Allelic VariantC, I104vA113V, IN COMPLEX WITH THE CHLORAMBUCIL-Glutathione Conjugate Length = 209 | Back alignment and structure |
| >pdb|2CZ2|A Chain A, Crystal Structure Of Glutathione Transferase Zeta 1-1 (Maleylacetoacetate Isomerase) From Mus Musculus (Form-1 Crystal) Length = 223 | Back alignment and structure |
| >pdb|4GSS|A Chain A, Human Glutathione S-Transferase P1-1 Y108f Mutant Length = 209 | Back alignment and structure |
| >pdb|17GS|A Chain A, Glutathione S-Transferase P1-1 Length = 210 | Back alignment and structure |
| >pdb|1GNW|A Chain A, Structure Of Glutathione S-Transferase Length = 211 | Back alignment and structure |
| >pdb|12GS|A Chain A, Glutathione S-transferase Complexed With S-nonyl-glutathione Length = 210 | Back alignment and structure |
| >pdb|22GS|A Chain A, Human Glutathione S-Transferase P1-1 Y49f Mutant Length = 210 | Back alignment and structure |
| >pdb|1LBK|A Chain A, Crystal Structure Of A Recombinant Glutathione Transferase, Created By Replacing The Last Seven Residues Of Each Subunit Of The Human Class Pi Isoenzyme With The Additional C-Terminal Helix Of Human Class Alpha Isoenzyme Length = 208 | Back alignment and structure |
| >pdb|4PGT|A Chain A, Crystal Structure Of Hgstp1-1[v104] Complexed With The Gsh Conjugate Of (+)-Anti-Bpde Length = 210 | Back alignment and structure |
| >pdb|1GSS|A Chain A, Three-Dimensional Structure Of Class Pi Glutathione S-Transferase From Human Placenta In Complex With S-Hexylglutathione At 2.8 Angstroms Resolution Length = 209 | Back alignment and structure |
| >pdb|2PGT|A Chain A, Crystal Structure Of Human Glutathione S-Transferase P1- 1[v104] Complexed With (9r,10r)-9-(S-Glutathionyl)-10- Hydroxy-9,10-Dihydrophenanthrene Length = 210 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 296 | |||
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 2e-61 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 1e-51 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 7e-61 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 4e-52 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 7e-61 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 3e-52 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 7e-60 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 4e-53 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 4e-58 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 3e-49 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 9e-58 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 6e-53 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 3e-54 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 4e-47 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 7e-51 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 2e-49 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 1e-50 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 1e-47 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 7e-49 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 3e-47 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 3e-45 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 2e-42 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 6e-44 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 7e-42 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 5e-40 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 4e-39 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 2e-37 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 2e-36 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 4e-36 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 1e-33 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 1e-35 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 1e-33 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 3e-33 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 2e-31 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 3e-32 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 4e-30 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 3e-30 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 1e-17 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 5e-30 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 2e-26 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 6e-28 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 2e-26 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 7e-28 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 2e-22 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 2e-27 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 2e-21 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 1e-26 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 3e-25 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 1e-26 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 2e-15 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 6e-26 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 6e-26 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 4e-25 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 3e-19 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 1e-24 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 3e-24 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 2e-24 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 1e-22 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 1e-23 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 3e-18 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 1e-22 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 1e-15 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 4e-22 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 6e-19 | |
| 4g9h_A | 211 | Glutathione S-transferase; GST, enzyme function in | 4e-22 | |
| 4g9h_A | 211 | Glutathione S-transferase; GST, enzyme function in | 1e-15 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 2e-21 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 2e-19 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 3e-21 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 4e-18 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 8e-21 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 5e-15 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 1e-20 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 5e-16 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 1e-20 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 2e-17 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 1e-19 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 9e-15 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 3e-19 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 1e-17 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 6e-18 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 2e-15 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 7e-18 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 9e-16 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 8e-18 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 6e-16 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 1e-17 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 3e-14 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 2e-17 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 3e-17 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 4e-17 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 2e-12 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 4e-17 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 7e-13 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 6e-17 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 1e-13 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 1e-16 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 2e-14 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 6e-16 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 2e-05 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 1e-15 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 2e-07 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 2e-15 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 2e-05 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 2e-15 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 2e-06 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 3e-15 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 6e-07 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 3e-15 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 2e-09 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 3e-15 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 4e-06 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 9e-15 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 5e-06 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 1e-14 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 3e-06 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 1e-14 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 4e-06 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 1e-14 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 8e-06 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 1e-14 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 6e-07 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 2e-14 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 2e-05 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 2e-14 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 2e-06 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 2e-14 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 1e-04 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 3e-14 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 6e-07 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 3e-14 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 1e-05 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 3e-14 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 1e-04 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 3e-14 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 3e-06 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 4e-14 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 1e-08 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 4e-14 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 2e-05 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 6e-14 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 6e-06 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 8e-14 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 2e-12 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 2e-11 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 4e-10 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 1e-13 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 3e-05 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 1e-13 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 8e-12 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 2e-13 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 1e-12 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 5e-13 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 8e-06 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 7e-13 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 5e-05 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 1e-12 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 1e-12 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 1e-05 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 1e-12 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 1e-05 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 2e-12 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 3e-10 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 3e-12 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 6e-10 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 3e-12 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 9e-06 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 7e-12 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 6e-10 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 9e-12 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 3e-10 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 1e-11 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 8e-10 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 2e-11 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 2e-11 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 3e-11 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 2e-11 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 2e-10 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 3e-11 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 4e-11 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 2e-09 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 4e-11 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 3e-10 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 1e-08 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-07 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 2e-05 |
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 | Back alignment and structure |
|---|
Score = 192 bits (491), Expect = 2e-61
Identities = 60/173 (34%), Positives = 92/173 (53%), Gaps = 10/173 (5%)
Query: 127 WIPIN------FSP---QLNPQHTVPTLEDGDLIVWDSHAINAYLVSAYGKNDALYPKDP 177
+ P +LNPQH +PTL D +W+S AI YL YGK+D LYPKDP
Sbjct: 28 LKLTDLMKGEHMKPEFLKLNPQHCIPTLVDNGFALWESRAIQIYLAEKYGKDDKLYPKDP 87
Query: 178 KVRALVDQRLHFDSGVLFSALRNIGLKIFFKNEKEIPEEDKLRAREALDFAEKFLQGRKF 237
+ RA+V+QRL+FD G L+ + F + PE +K + ++A+ F FL+G+++
Sbjct: 88 QKRAVVNQRLYFDMGTLYQRFADYHYPQIFAKQPANPENEK-KMKDAVGFLNTFLEGQEY 146
Query: 238 ITGDTYNIADFSIYTTASALVALVPGLEKYPNLAKYFDLCKSSFKGISHDEEG 290
G+ IAD S+ T + YPN+A +F CK++ G + ++ G
Sbjct: 147 AAGNDLTIADLSLAATIATYEVAGFDFAPYPNVAAWFARCKANAPGYALNQAG 199
|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 | Back alignment and structure |
|---|
| >4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Length = 244 | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Length = 244 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 100.0 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 100.0 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 100.0 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 100.0 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 100.0 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 100.0 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 100.0 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 100.0 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 100.0 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 100.0 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 100.0 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 100.0 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 100.0 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 100.0 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 100.0 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 100.0 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 100.0 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 100.0 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 100.0 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 100.0 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 100.0 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 100.0 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 100.0 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 100.0 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 100.0 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 100.0 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 100.0 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 100.0 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 100.0 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 100.0 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 100.0 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 100.0 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 100.0 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 100.0 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 100.0 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 100.0 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 100.0 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 100.0 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 100.0 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 100.0 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 100.0 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 100.0 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 100.0 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 100.0 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 100.0 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 100.0 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 100.0 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 100.0 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 99.98 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 99.98 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 99.98 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 99.98 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 99.98 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 99.98 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 99.98 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 99.98 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 99.98 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 99.98 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 99.98 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 99.97 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 99.97 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 99.97 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 99.97 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 99.97 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 99.97 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 99.97 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 99.97 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 99.97 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 99.97 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 99.97 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 99.97 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 99.97 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 99.97 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 99.97 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 99.97 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 99.97 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 99.97 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 99.97 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 99.97 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 99.97 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 99.97 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 99.97 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 99.97 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 99.97 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 99.97 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 99.97 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 99.97 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 99.97 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 99.97 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 99.97 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 99.97 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 99.97 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 99.96 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 99.96 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 99.96 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 99.96 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 99.96 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 99.96 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 99.95 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 99.95 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 99.95 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 99.95 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 99.94 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 99.94 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 99.93 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 99.92 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.92 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 99.92 | |
| 4g0i_A | 328 | Protein YQJG; glutathionyl-hydroquinone reductase, | 99.89 | |
| 4fqu_A | 313 | Putative glutathione transferase; glutathionyl-hyd | 99.88 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 99.87 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 99.86 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.82 | |
| 2hsn_A | 160 | Methionyl-tRNA synthetase, cytoplasmic; protein co | 99.72 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 99.59 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 99.58 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 99.55 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 99.54 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 99.53 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 99.51 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 99.48 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 99.46 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 99.45 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 99.43 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 99.43 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 99.38 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 99.31 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 99.27 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 99.27 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 99.21 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 99.16 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 99.12 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 99.12 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 99.1 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 99.09 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 99.08 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 99.08 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 99.07 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.02 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 98.98 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 98.98 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 98.97 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 98.97 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 98.96 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 98.96 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 98.95 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 98.95 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 98.95 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 98.94 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 98.91 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 98.9 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 98.89 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 98.89 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 98.88 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 98.88 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 98.87 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 98.87 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 98.87 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 98.86 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 98.85 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 98.84 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 98.83 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 98.83 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 98.83 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 98.8 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 98.8 | |
| 2hqt_A | 124 | GU4 nucleic-binding protein 1; GST-fold, biosynthe | 98.76 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 98.74 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 98.74 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 98.74 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 98.74 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 98.74 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 98.73 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 98.71 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 98.71 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 98.69 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 98.69 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 98.69 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 98.67 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 98.67 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 98.67 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 98.67 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 98.66 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 98.66 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 98.66 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 98.66 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 98.65 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 98.64 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 98.64 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 98.64 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 98.64 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 98.63 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 98.63 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 98.63 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 98.63 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 98.62 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 98.61 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 98.6 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 98.59 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 98.58 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 98.58 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 98.58 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 98.54 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 98.54 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 98.54 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 98.53 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 98.52 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 98.52 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 98.51 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 98.51 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 98.5 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 98.5 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 98.5 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 98.49 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 98.49 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 98.49 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 98.47 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 98.46 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 98.46 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 98.44 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 98.43 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 98.42 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 98.41 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 98.4 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 98.4 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 98.39 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 98.39 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 98.38 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 98.35 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 98.34 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 98.34 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 98.32 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 98.3 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 98.27 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 98.26 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 98.24 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 98.21 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 98.16 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 98.12 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 98.11 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 98.09 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 98.09 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 98.09 | |
| 4fqu_A | 313 | Putative glutathione transferase; glutathionyl-hyd | 98.09 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 98.07 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 98.05 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 98.04 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 98.02 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 97.97 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 97.97 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 97.95 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 97.94 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 97.86 | |
| 2hsn_A | 160 | Methionyl-tRNA synthetase, cytoplasmic; protein co | 97.84 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 97.83 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 97.83 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 97.83 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 97.71 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 97.65 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 97.61 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 97.6 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 97.59 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 97.56 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 97.53 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 97.44 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 97.42 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 97.12 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 97.11 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 97.08 | |
| 4g0i_A | 328 | Protein YQJG; glutathionyl-hydroquinone reductase, | 97.08 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 97.02 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 96.91 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 96.9 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 96.62 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 96.59 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 96.49 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 93.52 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 93.01 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 89.71 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 88.96 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 86.66 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 86.27 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 85.97 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 81.13 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 80.15 |
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-38 Score=288.53 Aligned_cols=272 Identities=22% Similarity=0.222 Sum_probs=215.1
Q ss_pred cEEEecCCCchhHHHHHHHHHhCCceeEEEecccccccchHHHHhhCCCccccEEeeCC---eeeeecHHHHHHHHHhcC
Q psy13748 3 LILHEIIASPPVRAVKLCLTELGLEAEYKTCNLLAREQFSDEYLKLNPQHTVPTLEDGD---LIVWDSHAINAYLVSAYG 79 (296)
Q Consensus 3 ~~Ly~~~~s~~~~~v~~~L~~~gi~~~~~~i~~~~~~~~~~~~~~~~p~~~vP~l~~~~---~~~~es~~I~~yl~~~~~ 79 (296)
++||+++.||+|++||++|+++||+|+.+.+++ +++.+++|+++||.|+||+|++++ .+++||.+|++||+++|+
T Consensus 27 ~~Ly~~~~sp~~~~v~~~L~~~gi~~e~~~v~~--~~~~~~~~~~~nP~g~vP~L~~~~~~g~~l~eS~aI~~yL~~~~~ 104 (471)
T 4ags_A 27 LKLYVSATCPFCHRVEIVAREKQVSYDRVAVGL--REEMPQWYKQINPRETVPTLEVGNADKRFMFESMLIAQYLDNSGA 104 (471)
T ss_dssp EEEEECTTCHHHHHHHHHHHHTTCCCEEEECCC--GGGCCHHHHHHCTTCCSCEEEECSSSCEEEESHHHHHHHHHHTSS
T ss_pred eEEECCCCCchHHHHHHHHHHcCCCCEEEEeCC--CCCccHHHHhhCCCCccCeEEECCcCeEEEecHHHHHHHHHHhcC
Confidence 999999999999999999999999999999998 345678999999999999999765 999999999999999985
Q ss_pred CCCCCCCCCHHHHHHHhhhhhccccchhhhh-------------------------------------------------
Q psy13748 80 KNDALYPKDPKVRALVDQRLHFDSGVLFSAL------------------------------------------------- 110 (296)
Q Consensus 80 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~------------------------------------------------- 110 (296)
....|+|.++.+|+.++.|+.+..+.+.+..
T Consensus 105 ~~~~L~p~~~~~ra~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~L~~~l~~~~~l~G~~~t~ADi~l~ 184 (471)
T 4ags_A 105 PAGALMGSSAAQRHQIEFFLAQVGDFIGAAHGLLRDPLSGEKRKAMDDNAAYVDGLLAANQTTGPYYCDGEFTMADVALV 184 (471)
T ss_dssp STTGGGCSSHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHHHHHHHHHCSSCSBTBBTBCCHHHHHHH
T ss_pred CCCCCCCCCHHHHHHHHHHHHHHhhhhHHHHHHhcCcccHHHHHHHHHHHHHHHHHHHhccCCCCeeCCCCCCHhHHHHH
Confidence 4567999999999999988875432221110
Q ss_pred ---hhh--------ccC---------------------------------------------------------------
Q psy13748 111 ---RNI--------GVS--------------------------------------------------------------- 116 (296)
Q Consensus 111 ---~~~--------~~~--------------------------------------------------------------- 116 (296)
..+ .++
T Consensus 185 ~~l~~~~~~~~~~~~~~~~~~~p~l~~w~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~L~~~~~sp~~ 264 (471)
T 4ags_A 185 PFLVRLKPALMYYAGYDVFCKAPRMKALWAAAAQRASVRETSPTAAQCIENYRHLVPESAPMMGANGGHVLYSNLFCPFV 264 (471)
T ss_dssp HHHHHHHHHHHHHHSCCTTTTCHHHHHHHHHHTTSHHHHTTCCCHHHHHHHHGGGSCTTSTTGGGTTSCEEEECTTCHHH
T ss_pred HHHHHHHHHhhhhcCCcccCCChHHHHHHHHHhcChHHHHhccCHHHHHHHHHhhccccCCCCCCCCcEEEEecCCCchH
Confidence 000 000
Q ss_pred ------------cceEeeccCCCCCCccccccCCCCCccEEE-eCCEEeeccHHHHHHHHHHhCCCCCCCCC-CHHHHHH
Q psy13748 117 ------------KTFCSDLYLGWIPINFSPQLNPQHTVPTLE-DGDLIVWDSHAINAYLVSAYGKNDALYPK-DPKVRAL 182 (296)
Q Consensus 117 ------------~~~~v~~~~~~~~~~~~~~~nP~~~vP~L~-~~g~~l~es~aI~~yl~~~~~~~~~l~~~-~~~~~~~ 182 (296)
....+.+.....+++| .+.||.|+||+|+ +||.+++||.+|++||+++++.++.|+|. ++.+++.
T Consensus 265 ~rv~~~L~~~gi~y~~~~v~~~~~~~~~-~~~~P~g~vP~L~~~~g~~l~eS~aI~~yL~~~~~~~~~L~p~~~~~~~a~ 343 (471)
T 4ags_A 265 DRARLASELRKFQMHIVEVPLHPQPEWY-KYINPRDTVPALFTPSGEAVHESQLIVQYIDCVATKGSALVPRGDAEKEYE 343 (471)
T ss_dssp HHHHHHHHHTTCCCEEEECCCSSCCTTH-HHHCTTCCSCEEECTTSCEEESHHHHHHHHHHHCCSSCCSSCTTCHHHHHH
T ss_pred HHHHHHHHHCCCCcEEEEecCCcCcHHH-HHhCCCCCcCeEEeCCCcEeecHHHHHHHHHhccCCCCCCCCCCChHHHHH
Confidence 0000222222223555 9999999999999 79999999999999999999777889999 9999999
Q ss_pred HHhHHhhccchhhhHHHHhhhhhhccCCcCCcHHHHHHHHHHHHHHHHHcCC-----CCCcCCCcccchhHhHHHHHHHH
Q psy13748 183 VDQRLHFDSGVLFSALRNIGLKIFFKNEKEIPEEDKLRAREALDFAEKFLQG-----RKFITGDTYNIADFSIYTTASAL 257 (296)
Q Consensus 183 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~-----~~~l~g~~~t~aD~~~~~~l~~~ 257 (296)
++.|..+....+. .+...+. . ..++..+.+.+.++.+|++|.+ ++||+|+++|+||+.+++.+.++
T Consensus 344 ~~~~~~~~~~~~~-~~~~~~~----~----~~~~~~~~~~~~l~~le~~L~~~~~~~~~fl~Gd~~t~ADi~l~~~l~~~ 414 (471)
T 4ags_A 344 VGFFVENAGYFVG-GLMSWII----R----GGEDAKAELQWAAGELEQQLAKHPFGEGPFFGGKRMNAGDVAILPFLVRA 414 (471)
T ss_dssp HHHHHHHHHHHHH-HHHHHHH----H----CCHHHHHHHHHHHHHHHHHHTTCTTCSSSBTTBSSCCHHHHHHHHHHHHH
T ss_pred HHHHHHHHhhhhH-HHHHHHh----c----ccHHHHHHHHHHHHHHHHHHHhcccCCCCccCCCCCcHHHHHHHHHHHHH
Confidence 9999998765322 2222111 1 1245677899999999999964 46999999999999999999988
Q ss_pred HhhC------CC-CCCchhHHHHHHHHhccccCcccC
Q psy13748 258 VALV------PG-LEKYPNLAKYFDLCKSSFKGISHD 287 (296)
Q Consensus 258 ~~~~------~~-~~~~p~l~~~~~~~~~~~p~~~~~ 287 (296)
.... .. ...||+|.+|++++.+ +|++++.
T Consensus 415 ~~~~~~~~~~~~~~~~~p~l~~w~~r~~~-~p~~~~~ 450 (471)
T 4ags_A 415 KAFMPEFSGGYDLFAHFPLLNGLAEAGMA-TPEAKSV 450 (471)
T ss_dssp HHHTTTTTTTCCGGGTCHHHHHHHHHHHT-SHHHHHH
T ss_pred HHHHHhhcCCccccccChHHHHHHHHHhc-CHHHHHh
Confidence 7652 22 4679999999999999 9999983
|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* | Back alignment and structure |
|---|
| >4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 296 | ||||
| d1v2aa1 | 125 | a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano | 5e-28 | |
| d1v2aa1 | 125 | a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano | 5e-08 | |
| d1r5aa1 | 129 | a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano | 8e-28 | |
| d1r5aa1 | 129 | a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano | 9e-08 | |
| d1jlva1 | 123 | a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano | 1e-24 | |
| d1jlva1 | 123 | a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano | 3e-07 | |
| d1r5aa2 | 85 | c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph | 5e-24 | |
| d1r5aa2 | 85 | c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph | 2e-08 | |
| d1jlwa1 | 127 | a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano | 1e-23 | |
| d1jlwa1 | 127 | a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano | 2e-06 | |
| d1jlva2 | 84 | c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph | 3e-23 | |
| d1jlva2 | 84 | c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph | 5e-09 | |
| d1ljra1 | 165 | a.45.1.1 (A:80-244) Class theta GST {Human (Homo s | 7e-19 | |
| d1ljra1 | 165 | a.45.1.1 (A:80-244) Class theta GST {Human (Homo s | 4e-06 | |
| d1ljra2 | 79 | c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap | 1e-17 | |
| d1axda2 | 80 | c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), | 1e-17 | |
| d1axda2 | 80 | c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), | 1e-04 | |
| d1v2aa2 | 83 | c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph | 3e-17 | |
| d1v2aa2 | 83 | c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph | 6e-08 | |
| d1axda1 | 129 | a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays | 3e-16 | |
| d1axda1 | 129 | a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays | 2e-06 | |
| d1e6ba2 | 80 | c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress | 2e-15 | |
| d1e6ba2 | 80 | c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress | 2e-05 | |
| d1k0da1 | 151 | a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni | 4e-15 | |
| d1aw9a2 | 81 | c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), | 4e-15 | |
| d1aw9a2 | 81 | c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), | 1e-04 | |
| d1fw1a2 | 83 | c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi | 4e-15 | |
| d1fw1a2 | 83 | c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi | 2e-06 | |
| d1gnwa2 | 84 | c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( | 7e-15 | |
| d1e6ba1 | 133 | a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres | 1e-12 | |
| d1gnwa1 | 126 | a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress | 8e-12 | |
| d1k0da2 | 92 | c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni | 9e-12 | |
| d2a2ra1 | 132 | a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapi | 9e-12 | |
| d1n2aa1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Escherichia co | 1e-11 | |
| d1gula1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s | 2e-11 | |
| d1b48a1 | 143 | a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu | 2e-11 | |
| d1pmta1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi | 3e-11 | |
| d1k3ya1 | 142 | a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s | 3e-11 | |
| d1oyja2 | 84 | c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ | 4e-11 | |
| d1oyja2 | 84 | c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ | 7e-04 | |
| d1nhya2 | 75 | c.47.1.5 (A:1-75) GST-like domain of elongation fa | 4e-11 | |
| d1nhya2 | 75 | c.47.1.5 (A:1-75) GST-like domain of elongation fa | 9e-04 | |
| d1aw9a1 | 135 | a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays | 1e-10 | |
| d1f2ea2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau | 1e-10 | |
| d1f2ea1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p | 2e-10 | |
| d1nhya1 | 144 | a.45.1.1 (A:76-219) GST-like domain of elongation | 2e-10 | |
| d1n2aa2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Escherichia coli | 2e-10 | |
| d1fw1a1 | 125 | a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sa | 3e-10 | |
| d1pmta2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili | 7e-10 | |
| d2a2ra2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien | 6e-09 | |
| d2a2ra2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien | 2e-04 | |
| d2c4ja2 | 84 | c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien | 7e-09 | |
| d2c4ja2 | 84 | c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien | 2e-04 | |
| d1k0ma2 | 86 | c.47.1.5 (A:6-91) Chloride intracellular channel 1 | 1e-08 | |
| d2gsta1 | 133 | a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv | 1e-08 | |
| d1gula2 | 77 | c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap | 1e-08 | |
| d1gula2 | 77 | c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap | 5e-05 | |
| d1gsua1 | 133 | a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus | 2e-08 | |
| d2fnoa2 | 87 | c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752 | 2e-08 | |
| d1gwca2 | 83 | c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii | 2e-08 | |
| d1eema2 | 98 | c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa | 2e-08 | |
| d1g7oa2 | 75 | c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli | 2e-08 | |
| d1g7oa2 | 75 | c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli | 5e-04 | |
| d1z9ha1 | 161 | a.45.1.1 (A:213-373) Microsomal prostaglandin E sy | 2e-08 | |
| d1z9ha2 | 113 | c.47.1.5 (A:100-212) Microsomal prostaglandin E sy | 1e-07 | |
| d2cvda1 | 124 | a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s | 2e-07 | |
| d1fhea2 | 80 | c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati | 3e-07 | |
| d1m0ua1 | 127 | a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D | 3e-07 | |
| d1gwca1 | 138 | a.45.1.1 (A:87-224) Class tau GST {Aegilops tausch | 3e-07 | |
| d1m0ua2 | 76 | c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr | 4e-07 | |
| d1m0ua2 | 76 | c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr | 0.002 | |
| d2c4ja1 | 133 | a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapi | 4e-07 | |
| d1duga1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Schistosoma j | 4e-07 | |
| d1k3ya2 | 79 | c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap | 4e-07 | |
| d1k3ya2 | 79 | c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap | 1e-04 | |
| d1tu7a2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu | 7e-07 | |
| d1tu7a2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu | 3e-04 | |
| d1b48a2 | 78 | c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc | 1e-06 | |
| d1tw9a2 | 77 | c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides | 3e-06 | |
| d1tw9a2 | 77 | c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides | 7e-04 | |
| d2cvda2 | 74 | c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap | 3e-06 | |
| d1okta2 | 85 | c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm | 6e-06 | |
| d1eema1 | 139 | a.45.1.1 (A:103-241) Class omega GST {Human (Homo | 6e-06 | |
| d2fhea1 | 136 | a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa | 7e-06 | |
| d2gsqa2 | 75 | c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre | 1e-05 | |
| d2gsqa1 | 127 | a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommast | 1e-05 | |
| d1tu7a1 | 131 | a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu | 1e-05 | |
| d1duga2 | 80 | c.47.1.5 (A:1-80) Class alpha GST {Schistosoma jap | 1e-05 | |
| d3gtub1 | 140 | a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapi | 2e-05 | |
| d1oe8a1 | 123 | a.45.1.1 (A:85-207) Class alpha GST {Blood fluke ( | 8e-05 | |
| d1oe8a2 | 81 | c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Sc | 2e-04 |
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Class delta GST species: Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]
Score = 102 bits (256), Expect = 5e-28
Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 2/109 (1%)
Query: 175 KDPKVRALVDQRLHFDSGVLFSALRNIGLKIFFKNEKEIPEEDKLRAREALDFAEKFLQG 234
KDPKVR++V+QRL FD G L+ + ++ + K ++ +E + + ALD E+F+
Sbjct: 1 KDPKVRSVVNQRLFFDIGTLYKRIIDVIHLVMKK--EQPSDEQMEKLKGALDLLEQFVTE 58
Query: 235 RKFITGDTYNIADFSIYTTASALVALVPGLEKYPNLAKYFDLCKSSFKG 283
R + D +AD + T +AL L LE +P++ + + ++
Sbjct: 59 RAYAAADHLTVADICLLGTVTALNWLKHDLEPFPHIRAWLERVRAEMPD 107
|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126 | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 132 | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 135 | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 144 | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 161 | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 113 | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127 | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 138 | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 140 | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136 | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 127 | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131 | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 80 | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123 | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 81 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.92 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.91 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.9 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.9 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.9 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.9 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.89 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.88 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.87 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 99.87 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.86 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.83 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 99.82 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.82 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.82 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.82 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.81 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 99.8 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.79 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 99.79 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.77 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.77 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.77 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.76 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.76 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 99.75 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.74 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.74 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.73 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 99.72 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.7 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.69 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 99.69 | |
| d1n2aa1 | 121 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.69 | |
| d1jlwa1 | 127 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.65 | |
| d1pmta1 | 121 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.65 | |
| d1v2aa1 | 125 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.65 | |
| d1jlva1 | 123 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.64 | |
| d1f2ea1 | 121 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.63 | |
| d1axda1 | 129 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.63 | |
| d1r5aa1 | 129 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.62 | |
| d1fw1a1 | 125 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.61 | |
| d1aw9a1 | 135 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.59 | |
| d1oe8a2 | 81 | Class alpha GST {Blood fluke (Schistosoma haematob | 99.56 | |
| d1nhya1 | 144 | GST-like domain of elongation factor 1-gamma {Bake | 99.56 | |
| d1e6ba1 | 133 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.55 | |
| d1k0da1 | 151 | Yeast prion protein ure2p, nitrogen regulation fra | 99.54 | |
| d1gnwa1 | 126 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.53 | |
| d1gwca1 | 138 | Class tau GST {Aegilops tauschii, also known as Tr | 99.53 | |
| d1ljra1 | 165 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.52 | |
| d3gtub1 | 140 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d1eema1 | 139 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.42 | |
| d2cvda1 | 124 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.41 | |
| d2a2ra1 | 132 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d2gsqa1 | 127 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.4 | |
| d2gsta1 | 133 | Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 | 99.39 | |
| d2c4ja1 | 133 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.38 | |
| d1k3ya1 | 142 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.38 | |
| d1b48a1 | 143 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.37 | |
| d1gula1 | 140 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.37 | |
| d1gsua1 | 133 | Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 | 99.36 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.36 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.33 | |
| d1m0ua1 | 127 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.33 | |
| d2fhea1 | 136 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.29 | |
| d1duga1 | 140 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.28 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.26 | |
| d1tw9a1 | 129 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.22 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.22 | |
| d1oyja1 | 145 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.21 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.21 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.17 | |
| d1okta1 | 126 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.13 | |
| d1tu7a1 | 131 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.11 | |
| d2hrkb1 | 118 | GU4 nucleic-binding protein 1, Arc1p {Baker's yeas | 99.1 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.03 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.02 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.0 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.0 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 98.99 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 98.99 | |
| d1oe8a1 | 123 | Class alpha GST {Blood fluke (Schistosoma haematob | 98.92 | |
| d1k0ma1 | 149 | Chloride intracellular channel 1 (clic1) {Human (H | 98.92 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 98.92 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 98.92 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 98.91 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 98.88 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 98.87 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 98.85 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 98.84 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 98.8 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 98.79 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 98.78 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 98.76 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 98.76 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 98.75 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 98.75 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 98.73 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 98.73 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 98.72 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 98.69 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 98.66 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 98.65 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 98.64 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 98.53 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 98.48 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 98.46 | |
| d1z9ha1 | 161 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.41 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 98.19 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 98.08 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 98.05 | |
| d1oe8a2 | 81 | Class alpha GST {Blood fluke (Schistosoma haematob | 97.91 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 97.9 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 97.6 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 97.56 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 97.54 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 97.5 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 97.15 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 96.43 | |
| d1g7oa1 | 140 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 96.14 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 95.5 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 94.26 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 92.69 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 91.55 | |
| d2fnoa1 | 149 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 88.97 | |
| d1e6ba1 | 133 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 84.96 | |
| d1k0da1 | 151 | Yeast prion protein ure2p, nitrogen regulation fra | 83.76 | |
| d1tu7a1 | 131 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 82.01 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 81.76 | |
| d1gwca1 | 138 | Class tau GST {Aegilops tauschii, also known as Tr | 80.88 | |
| d1fw1a1 | 125 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 80.4 |
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Glutathione S-transferase (GST), N-terminal domain domain: Class delta GST species: Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]
Probab=99.92 E-value=3.5e-25 Score=150.67 Aligned_cols=84 Identities=43% Similarity=0.775 Sum_probs=79.7
Q ss_pred cEEEecCCCchhHHHHHHHHHhCCceeEEEecccccccchHHHHhhCCCccccEEeeCCeeeeecHHHHHHHHHhcCCCC
Q psy13748 3 LILHEIIASPPVRAVKLCLTELGLEAEYKTCNLLAREQFSDEYLKLNPQHTVPTLEDGDLIVWDSHAINAYLVSAYGKND 82 (296)
Q Consensus 3 ~~Ly~~~~s~~~~~v~~~L~~~gi~~~~~~i~~~~~~~~~~~~~~~~p~~~vP~l~~~~~~~~es~~I~~yl~~~~~~~~ 82 (296)
|+||+++.|++|++||++|+++|++|+.+.+++..+++.+++|+++||.|+||+|++||.+++||.+|++||+++|+++.
T Consensus 1 mkLY~~~~S~~~~~v~~~l~e~gi~~e~~~v~~~~~~~~~~~~~~~nP~g~vP~L~d~~~~l~ES~aI~~yL~~~~~~~~ 80 (84)
T d1jlva2 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKINPQHCIPTLVDNGFALWESRAICTYLAEKYGKDD 80 (84)
T ss_dssp CEEEECTTCHHHHHHHHHHHHTTCCCEEEECCGGGTGGGSHHHHHHCTTCCSCEEEETTEEEESHHHHHHHHHHHHCCCG
T ss_pred CEEEcCCCCHHHHHHHHHHHHcCCCCEEEEecCCCCccCCHHHHHHhccccCCEEEECCEEEEcHHHHHHHHHHHcCCCC
Confidence 69999999999999999999999999999999998888899999999999999999999999999999999999998765
Q ss_pred CCCC
Q psy13748 83 ALYP 86 (296)
Q Consensus 83 ~l~~ 86 (296)
.|+|
T Consensus 81 ~L~P 84 (84)
T d1jlva2 81 KLYP 84 (84)
T ss_dssp GGSC
T ss_pred CCCC
Confidence 6765
|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|