Diaphorina citri psyllid: psy13755

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610--

MIKNNLICRKIYYNLRKKKKQIRLNLSSTRGGRKDKNADDDADSWVDVTSDPESDQEKMEDSNDNEESKDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELALKTYNQVLKENLPLLHMRNIPSFIQKQLNSNSKDRKMVKYQKYVEKSLSIIVQSYSNLNRKDGEGTAKETNQIKDERNEKSAEVKEEHPREVIVQVDDLVKDNETETSEEKRPLELINNHIDENNQSKDINVLFPNVVGEDKMNIFSDSDGSYVVMRVEANRPTLKDSDTLEPFKLKDTDQLKYNDGKLEADLEELLNKDLPFHANTNIICNTSRSASKMQRRNSSTPSKMWSTANYIRLNIKHKWDERLSHKDKTCKEDNVPSYPRDNVNPAKDICHIDVKLADLGNACWRDKHFSRDIQTRQYRSIEVLLRSGYDTSADIWSVACMAFELATGDYLFDPHTQNGWTRNEDHIGIIMRFLVTSDLHTCEK

cccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEccccccccEEEEEEEcccccccEEEEEEccccEEEEEEEEEccccccccHHHHHHHHHHHHccccccccccccccccccEEEEcccccEEEEEcccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccHHccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccHHHHcc

********************************************************************KDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLKCVQE****DPNREKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELALKTYNQV********************************************************************************************************************************NV*GEDKMNIFSDSDGSYVVMRV******************************************LPFHANT***********************MWSTANYIRLNI********************PSYPRDNVNPAKDICHIDVKLADLGNACWRDKHFSRDIQTRQYRSIEVLLRSGYDTSADIWSVACMAFELATGDYLFDPHTQNGWTRNEDHIGIIMRFLVTSDLHTCEK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
SRSF protein kinase 2	Serine/arginine-rich protein-specific kinase which specifically phosphorylates its substrates at serine residues located in regions rich in arginine/serine dipeptides, known as RS domains and is involved in the phosphorylation of SR splicing factors and the regulation of splicing. Promotes neuronal apoptosis by up-regulating cyclin-D1 (CCND1) expression. This is done by the phosphorylation of SRSF2, leading to the suppression of p53/TP53 phosphorylation thereby relieving the repressive effect of p53/TP53 on cyclin-D1 (CCND1) expression. Phosphorylates ACIN1, and redistributes it from the nuclear speckles to the nucleoplasm, resulting in cyclin A1 but not cyclin A2 up-regulation. Plays an essential role in splicesomal B complex formation via the phosphorylation of DDX23/PRP28. Can mediate hepatitis B virus (HBV) core protein phosphorylation. Plays a negative role in the regulation of HBV replication through a mechanism not involving the phosphorylation of the core protein but by reducing the packaging efficiency of the pregenomic RNA (pgRNA) without affecting the formation of the viral core particles.	confident	P78362

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000245 [BP]	spliceosomal complex assembly	probable	GO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397
GO:0004674 [MF]	protein serine/threonine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0045071 [BP]	negative regulation of viral genome replication	probable	GO:2000242, GO:0050792, GO:0045069, GO:2000241, GO:0050794, GO:0008150, GO:0043900, GO:0043901, GO:0065007, GO:0048525, GO:0048519, GO:0050789, GO:0048523
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0006468 [BP]	protein phosphorylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0000287 [MF]	magnesium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045070 [BP]	positive regulation of viral genome replication	probable	GO:0050792, GO:0045069, GO:2000241, GO:0050794, GO:0043902, GO:0043900, GO:0065007, GO:0008150, GO:2000243, GO:0048518, GO:0048524, GO:0050789, GO:0048522
GO:0007243 [BP]	intracellular protein kinase cascade	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0043525 [BP]	positive regulation of neuron apoptotic process	probable	GO:0050789, GO:0050794, GO:0043065, GO:0010942, GO:0043067, GO:0043523, GO:0065007, GO:0048518, GO:1901216, GO:0008150, GO:1901214, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0007059 [BP]	chromosome segregation	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0071889 [MF]	14-3-3 protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0045787 [BP]	positive regulation of cell cycle	probable	GO:0051726, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0048024 [BP]	regulation of mRNA splicing, via spliceosome	probable	GO:0051252, GO:0080090, GO:0019222, GO:0060255, GO:0050684, GO:0043484, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0010468
GO:0001525 [BP]	angiogenesis	probable	GO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0010628 [BP]	positive regulation of gene expression	probable	GO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604
GO:0035063 [BP]	nuclear speck organization	probable	GO:0006996, GO:0006997, GO:0009987, GO:0030575, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.11.-	Protein-serine/threonine kinases.	probable
2.7.11.1	Transferred entry: 2.7.11.19.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q8Y, chain A
Confidence level:very confident
Coverage over the Query: 76-233
View the alignment between query and template
View the model in PyMOL

Template: 2EU9, chain A
Confidence level:very confident
Coverage over the Query: 73-318
View the alignment between query and template
View the model in PyMOL

Template: 3LLT, chain A
Confidence level:very confident
Coverage over the Query: 446-609
View the alignment between query and template
View the model in PyMOL

Template: 1CKJ, chain A
Confidence level:probable
Coverage over the Query: 88-118,137-336
View the alignment between query and template
View the model in PyMOL

Template: 3K2L, chain A
Confidence level:probable
Coverage over the Query: 10-54,87-230
View the alignment between query and template
View the model in PyMOL