Psyllid ID: psy13755


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610--
MIKNNLICRKIYYNLRKKKKQIRLNLSSTRGGRKDKNADDDADSWVDVTSDPESDQEKMEDSNDNEESKDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELALKTYNQVLKENLPLLHMRNIPSFIQKQLNSNSKDRKMVKYQKYVEKSLSIIVQSYSNLNRKDGEGTAKETNQIKDERNEKSAEVKEEHPREVIVQVDDLVKDNETETSEEKRPLELINNHIDENNQSKDINVLFPNVVGEDKMNIFSDSDGSYVVMRVEANRPTLKDSDTLEPFKLKDTDQLKYNDGKLEADLEELLNKDLPFHANTNIICNTSRSASKMQRRNSSTPSKMWSTANYIRLNIKHKWDERLSHKDKTCKEDNVPSYPRDNVNPAKDICHIDVKLADLGNACWRDKHFSRDIQTRQYRSIEVLLRSGYDTSADIWSVACMAFELATGDYLFDPHTQNGWTRNEDHIGIIMRFLVTSDLHTCEK
cccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccEEEEEEEcccccccEEEEEEccccEEEEEEEEEccccccccHHHHHHHHHHHHHcccccccccccccccccEEEEcccccEEEEEcccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccHHHHcccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccHHHHHc
cccccEEEHHHcccccccccccccccccccccccccccccccccccccccccccHHHcccccHHcccHHHccccccccEEEcccccccEEEEEEEEEcccEEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHHHHccccHHHHHHHccEccccEEEEEEccccEEEEEEEEccccEHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcEEcccccHHHEEcEEcHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccEccEEccHHHcEEccEccccccccHHHccHHHHcccccccHHHHHHHHHHHHHHHHcccccccccEccEcHHHHHHHHHHHHHccccHHHHcc
MIKNNLICRKIYYNLRKKKKQIRLNLsstrggrkdknadddadswvdvtsdpesdqekmedsndneeskdyrvggyhpvnigdlYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLkcvqetdpqdpnrEKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKsnnkgiplynVKCIVKQLLEALEYLHNKcniihtdikpenvllgsnnDHIFELALKTYNQVLKEnlpllhmrnipSFIQKQLNSNSKDRKMVKYQKYVEKSLSIIVQSYSnlnrkdgegtaketNQIKderneksaevkeehpreVIVQVDDLvkdnetetseekrpLELINnhidennqskdinvlfpnvvgedkmnifsdsdgsYVVMRVEanrptlkdsdtlepfklkdtdqlkyndgkLEADLEELLnkdlpfhantniicntsrsaskmqrrnsstpskmwsTANYIRLNIKHkwderlshkdktckednvpsyprdnvnpakdichiDVKLADlgnacwrdkhfsrdiqTRQYRSIEVLLRsgydtsadIWSVACMAFELatgdylfdphtqngwtrnedHIGIIMRFLVTsdlhtcek
MIKNNLICRKIYynlrkkkkqirlnlsstrggrkdknadddadswvdvtsdpesdqekmedsndneeskdyrvGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELALKTYNQVLKENLPLLHMRNIPSFIQkqlnsnskdrKMVKYQKYVEKSLSIIVQSysnlnrkdgegtaketnqikderneksaevkeehprevivqvddlvkdnetetseekrplelinnhidennqskdiNVLFPNVVGEDKMNIFSDSDGSYVVMRVEANrptlkdsdtlepfklkdtdqlkyNDGKLEADLEELLNKDLPFHANTNIICntsrsaskmqrrnsstpskmwstaNYIRLNIKHkwderlshkdktckednvpsyprdnvnpaKDICHIDVKLADLGNACWRDKhfsrdiqtrqyRSIEVLLRSGYDTSADIWSVACMAFELATGDYLFDPHTQNGWTRNEDHIGIIMRFLvtsdlhtcek
MIKNNLICRKIYYNLRKKKKQIRLNLSSTRGGRKDKNADDDADSWVDVTSDPESDQEKMEDSNDNEESKDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELALKTYNQVLKENLPLLHMRNIPSFIQKQLNSNSKDRKMVKYQKYVEKSLSIIVQSYSNLNRKDGEGTAKETNQIKDERNEKSAEVKEEHPREVIVQVDDLVKDNETETSEEKRPLELINNHIDENNQSKDINVLFPNVVGEDKMNIFSDSDGSYVVMRVEANRPTLKDSDTLEPFKLKDTDQLKYNDGKLEADLEELLNKDLPFHANTNIICNTSRSASKMQRRNSSTPSKMWSTANYIRLNIKHKWDERLSHKDKTCKEDNVPSYPRDNVNPAKDICHIDVKLADLGNACWRDKHFSRDIQTRQYRSIEVLLRSGYDTSADIWSVACMAFELATGDYLFDPHTQNGWTRNEDHIGIIMRFLVTSDLHTCEK
****NLICRKIYYNLRK*****************************************************YRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLKCVQE********EKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELALKTYNQVLKENLPLLHMRNIPSFIQK**********MVKYQKYVEKSLSIIVQSY*************************************************************************DINVLFPNVVGEDKMNIFSDSDGSYVVMRV********************************ADLEELLNKDLPFHANTNIICN*******************WSTANYIRLNIKHKWDER********************VNPAKDICHIDVKLADLGNACWRDKHFSRDIQTRQYRSIEVLLRSGYDTSADIWSVACMAFELATGDYLFDPHTQNGWTRNEDHIGIIMRFLVTSDLH****
********************************************************************KDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLKCVQE****DPNREKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFE**********************************************************************************************************************************************************************************************************LPFHANT***********************MWSTANYIRLNI********************PSYPRDNVNPAKDICHIDVKLADLGNACWRDKHFSRDIQTRQYRSIEVLLRSGYDTSADIWSVACMAFELATGDYLFDPHTQNGWTRNEDHIGIIMRFLVTSDLHTCEK
MIKNNLICRKIYYNLRKKKKQIRLNLSST****************************************DYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELALKTYNQVLKENLPLLHMRNIPSFIQKQLNSNSKDRKMVKYQKYVEKSLSIIVQSYSNLNRKDGEGTAKETNQIKD*************PREVIVQVDDLVKDNETETSEEKRPLELINNHIDENNQSKDINVLFPNVVGEDKMNIFSDSDGSYVVMRVEANRPTLKDSDTLEPFKLKDTDQLKYNDGKLEADLEELLNKDLPFHANTNIICNTSR***************MWSTANYIRLNIKHKWDERLSHKDKTCKEDNVPSYPRDNVNPAKDICHIDVKLADLGNACWRDKHFSRDIQTRQYRSIEVLLRSGYDTSADIWSVACMAFELATGDYLFDPHTQNGWTRNEDHIGIIMRFLVTSDLHTCEK
*****************************************************************EESKDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELALKTYNQV********************************************************************************************************************************NV*GEDKMNIFSDSDGSYVVMRVEAN*****************************************************************************************************PSYPRDNVNPAKDICHIDVKLADLGNACWRDKHFSRDIQTRQYRSIEVLLRSGYDTSADIWSVACMAFELATGDYLFDPHTQNGWTRNEDHIGIIMRFLVTSDLHTCEK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKNNLICRKIYYNLRKKKKQIRLNLSSTRGGRKDKNADDDADSWVDVTSDPESDQEKMEDSNDNEESKDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELALKTYNQVLKENLPLLHMRNIPSFIQKQLNSNSKDRKMVKYQKYVEKSLSIIVQSYSNLNRKDGEGTAKETNQIKDERNEKSAEVKEEHPREVIVQVDDLVKDNETETSEEKRPLELINNHIDENNQSKDINVLFPNVVGEDKMNIFSDSDGSYVVMRVEANRPTLKDSDTLEPFKLKDTDQLKYNDGKLEADLEELLNKDLPFHANTNIICNTSRSASKMQRRNSSTPSKMWSTANYIRLNIKHKWDERLSHKDKTCKEDNVPSYPRDNVNPAKDICHIDVKLADLGNACWRDKHFSRDIQTRQYRSIEVLLRSGYDTSADIWSVACMAFELATGDYLFDPHTQNGWTRNEDHIGIIMRFLVTSDLHTCEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query612 2.2.26 [Sep-21-2011]
P78362688 SRSF protein kinase 2 OS= yes N/A 0.859 0.764 0.374 2e-96
O54781681 SRSF protein kinase 2 OS= yes N/A 0.517 0.465 0.408 2e-65
Q9UPE1567 SRSF protein kinase 3 OS= no N/A 0.295 0.319 0.635 2e-65
Q9Z0G2565 SRSF protein kinase 3 OS= yes N/A 0.295 0.320 0.635 3e-65
B8Y466566 SRSF protein kinase 3 OS= no N/A 0.295 0.319 0.635 6e-65
Q96SB4655 SRSF protein kinase 1 OS= no N/A 0.310 0.290 0.596 9e-63
Q5RD27655 SRSF protein kinase 1 OS= no N/A 0.310 0.290 0.596 1e-62
O70551648 SRSF protein kinase 1 OS= no N/A 0.310 0.293 0.591 1e-61
Q61IS6 1132 Serine/threonine-protein N/A N/A 0.348 0.188 0.523 7e-60
Q035631003 Serine/threonine-protein yes N/A 0.349 0.213 0.523 8e-59
>sp|P78362|SRPK2_HUMAN SRSF protein kinase 2 OS=Homo sapiens GN=SRPK2 PE=1 SV=3 Back     alignment and function desciption
 Score =  353 bits (906), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 218/582 (37%), Positives = 310/582 (53%), Gaps = 56/582 (9%)

Query: 61  DSNDNEESKDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIM 120
           D  + E+  DY  GGYHPV IGDL+  RY VIRKLGWGHFSTVWLCWD    RFVA+K++
Sbjct: 53  DDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVV 112

Query: 121 KSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFN 180
           KSA  YTETA+DEIKLLKCV+E+DP DPN++ +VQL+D+F ISG++G+H+CMV EV G +
Sbjct: 113 KSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHH 172

Query: 181 TYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFEL 240
             K ++KSN +G+P+  VK I++Q+L+ L+YLH+KC IIHTDIKPEN+L+  ++ ++  +
Sbjct: 173 LLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRM 232

Query: 241 ALKTYNQVLKENLPLLHMRNIPSFIQKQ-------LNSNSKDRKMVKYQKYVEKSLSIIV 293
           A +   +  K   P      + +  Q++              +K  +  + +EK L  I 
Sbjct: 233 AAEA-TEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIE 291

Query: 294 QSYSNLNRKDGEGTAKETNQIKDERNEKSAEVKEEHPREVIVQVDDLVKDN-ETETSEEK 352
           +      RK  E          D+  E   EVK +          +  KDN E E  EEK
Sbjct: 292 ELEREAERKIIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEK 351

Query: 353 RPLELINNHIDENNQSKDINVLFPNVVGEDKMN------IFSDSDGSYVVMRVEANRPTL 406
              E  N   DE++  +++  + P  +   K N       FS           E + P  
Sbjct: 352 EDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNP 411

Query: 407 KDSDTLEPFKLKD---TDQLKYNDGKLEADLEELLNKDLPFHANT-------NIICNTSR 456
           ++ +  EP    D   +   +  +G+L     ++     P  + +        + C +  
Sbjct: 412 EEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVL 471

Query: 457 S-ASKMQRRNSSTPSKMWSTANYIRLNIKHKWDERLSHKDKTCKEDNVPSYPRDN----- 510
           S  S +  +  S+PS                       + +T    +    P+       
Sbjct: 472 SEGSPLTEQEESSPSH---------------------DRSRTVSASSTGDLPKAKTRAAD 510

Query: 511 --VNP--AKDICHIDVKLADLGNACWRDKHFSRDIQTRQYRSIEVLLRSGYDTSADIWSV 566
             VNP   ++   I VK+ADLGNACW  KHF+ DIQTRQYRSIEVL+ +GY T ADIWS 
Sbjct: 511 LLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWST 570

Query: 567 ACMAFELATGDYLFDPHTQNGWTRNEDHIGIIMRFLVTSDLH 608
           ACMAFELATGDYLF+PH+   ++R+EDHI  I+  L +   H
Sbjct: 571 ACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRH 612




Serine/arginine-rich protein-specific kinase which specifically phosphorylates its substrates at serine residues located in regions rich in arginine/serine dipeptides, known as RS domains and is involved in the phosphorylation of SR splicing factors and the regulation of splicing. Promotes neuronal apoptosis by up-regulating cyclin-D1 (CCND1) expression. This is done by the phosphorylation of SRSF2, leading to the suppression of p53/TP53 phosphorylation thereby relieving the repressive effect of p53/TP53 on cyclin-D1 (CCND1) expression. Phosphorylates ACIN1, and redistributes it from the nuclear speckles to the nucleoplasm, resulting in cyclin A1 but not cyclin A2 up-regulation. Plays an essential role in splicesomal B complex formation via the phosphorylation of DDX23/PRP28. Can mediate hepatitis B virus (HBV) core protein phosphorylation. Plays a negative role in the regulation of HBV replication through a mechanism not involving the phosphorylation of the core protein but by reducing the packaging efficiency of the pregenomic RNA (pgRNA) without affecting the formation of the viral core particles.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|O54781|SRPK2_MOUSE SRSF protein kinase 2 OS=Mus musculus GN=Srpk2 PE=1 SV=2 Back     alignment and function description
>sp|Q9UPE1|SRPK3_HUMAN SRSF protein kinase 3 OS=Homo sapiens GN=SRPK3 PE=2 SV=2 Back     alignment and function description
>sp|Q9Z0G2|SRPK3_MOUSE SRSF protein kinase 3 OS=Mus musculus GN=Srpk3 PE=2 SV=1 Back     alignment and function description
>sp|B8Y466|SRPK3_PIG SRSF protein kinase 3 OS=Sus scrofa GN=SRPK3 PE=2 SV=1 Back     alignment and function description
>sp|Q96SB4|SRPK1_HUMAN SRSF protein kinase 1 OS=Homo sapiens GN=SRPK1 PE=1 SV=2 Back     alignment and function description
>sp|Q5RD27|SRPK1_PONAB SRSF protein kinase 1 OS=Pongo abelii GN=SRPK1 PE=2 SV=2 Back     alignment and function description
>sp|O70551|SRPK1_MOUSE SRSF protein kinase 1 OS=Mus musculus GN=Srpk1 PE=1 SV=2 Back     alignment and function description
>sp|Q61IS6|SPK1_CAEBR Serine/threonine-protein kinase spk-1 OS=Caenorhabditis briggsae GN=spk-1 PE=3 SV=2 Back     alignment and function description
>sp|Q03563|SPK1_CAEEL Serine/threonine-protein kinase spk-1 OS=Caenorhabditis elegans GN=spk-1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query612
395539153686 PREDICTED: SRSF protein kinase 2 [Sarcop 0.866 0.772 0.386 3e-97
380815898687 serine/threonine-protein kinase SRPK2 is 0.849 0.756 0.376 2e-95
335295613686 PREDICTED: LOW QUALITY PROTEIN: serine/t 0.859 0.766 0.372 3e-95
3406051675 serine kinase SRPK2-alternatively splice 0.849 0.770 0.376 5e-95
402864484698 PREDICTED: SRSF protein kinase 2 isoform 0.859 0.753 0.374 5e-95
383872997687 SRSF protein kinase 2 [Macaca mulatta] g 0.859 0.765 0.374 7e-95
332868202698 PREDICTED: SRSF protein kinase 2 [Pan tr 0.859 0.753 0.374 7e-95
33188449699 SRSF protein kinase 2 isoform a [Homo sa 0.859 0.752 0.374 7e-95
343961215698 serine/threonine-protein kinase SRPK2 [P 0.859 0.753 0.374 1e-94
61369026689 SFRS protein kinase 2 [synthetic constru 0.859 0.763 0.374 1e-94
>gi|395539153|ref|XP_003771537.1| PREDICTED: SRSF protein kinase 2 [Sarcophilus harrisii] Back     alignment and taxonomy information
 Score =  362 bits (929), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 219/566 (38%), Positives = 315/566 (55%), Gaps = 36/566 (6%)

Query: 61  DSNDNEESKDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIM 120
           D  + E+  DY  GGYHPV IGDL+  RY VIRKLGWGHFSTVWLCWD    RFVA+K++
Sbjct: 51  DDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVV 110

Query: 121 KSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFN 180
           KSA  YTETA+DEIKLLKCV+E+DP DPN++ +VQL+D+F ISG++G+H+CMV EV G +
Sbjct: 111 KSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHH 170

Query: 181 TYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFEL 240
             K ++KSN +G+P++ VK I++Q+L+ L+YLH+KC IIHTDIKPEN+L+  ++ ++  +
Sbjct: 171 LLKWIIKSNYQGLPIHCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDTYVRRM 230

Query: 241 ALKTYNQVLKENLPLLHMRNIPSFIQKQ-------LNSNSKDRKMVKYQKYVEKSLSIIV 293
           A +   +  K   P      + +  Q++              +K  +  + +EK L  I 
Sbjct: 231 AAEA-TEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIE 289

Query: 294 QSYSNLNRKDGEGTAKETNQIKDERNE-------KSAEVKEEHPREVIVQVDDLVKDNET 346
           +      RK  E     T    D+ +E       K+AE+KE    E     +D   D ET
Sbjct: 290 ELEREAERKKIEENISSTIPTNDQEDEYHPEVKLKTAELKEAADEE---PAND---DGET 343

Query: 347 ETSEEKRPLELINNHIDENNQSKDINVLFPNVVGEDKMNIFSDSDGSYVVMRVEANRPTL 406
           E  EEK   E  N   D+++  +++    P  +   K N   ++    +  ++E      
Sbjct: 344 EDQEEKEDTEKENTEKDDDDVEQELANTDPTWIESPKTNGHIENGPFLLEQQIEDEEDDE 403

Query: 407 KDSDTLEPFKLKDTDQLKYNDGKLEADLEELLNKDLPFHANTNIICNTSRSASKMQRRNS 466
           ++    E + L   D+         +   E  N DLP     + I  +  S       + 
Sbjct: 404 EECPNPEEYNL---DEPNAESDYTYSSSYEQFNGDLP--NGRHKIPESQFSEFTASMFSG 458

Query: 467 STPSKMWSTANYIRLNIKHKWDERLSH-KDKTCKEDNVPSYPRDN-------VNP--AKD 516
           +  S    +A      +  + +   SH + +T    +    P+         VNP   ++
Sbjct: 459 ALESVACGSAVSDGSALTEREENSPSHDRSRTVSASSTGDLPKTKTRAADLLVNPLDPRN 518

Query: 517 ICHIDVKLADLGNACWRDKHFSRDIQTRQYRSIEVLLRSGYDTSADIWSVACMAFELATG 576
              I VK+ADLGNACW  KHF+ DIQTRQYRSIEVL+ +GY T ADIWS ACMAFELATG
Sbjct: 519 ADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATG 578

Query: 577 DYLFDPHTQNGWTRNEDHIGIIMRFL 602
           DYLF+PH+   ++R+EDHI +I+  L
Sbjct: 579 DYLFEPHSGEDYSRDEDHIALIIELL 604




Source: Sarcophilus harrisii

Species: Sarcophilus harrisii

Genus: Sarcophilus

Family: Dasyuridae

Order: Dasyuromorphia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|380815898|gb|AFE79823.1| serine/threonine-protein kinase SRPK2 isoform b [Macaca mulatta] Back     alignment and taxonomy information
>gi|335295613|ref|XP_003357550.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase SRPK2-like [Sus scrofa] Back     alignment and taxonomy information
>gi|3406051|gb|AAC29141.1| serine kinase SRPK2-alternatively spliced form; similar to U88666 (PID:g1857944); alternatively spliced form of H_RG152G17.1a [Homo sapiens] Back     alignment and taxonomy information
>gi|402864484|ref|XP_003896493.1| PREDICTED: SRSF protein kinase 2 isoform 2 [Papio anubis] gi|380815896|gb|AFE79822.1| serine/threonine-protein kinase SRPK2 isoform a [Macaca mulatta] gi|384948998|gb|AFI38104.1| serine/threonine-protein kinase SRPK2 isoform a [Macaca mulatta] Back     alignment and taxonomy information
>gi|383872997|ref|NP_001244401.1| SRSF protein kinase 2 [Macaca mulatta] gi|402864482|ref|XP_003896492.1| PREDICTED: SRSF protein kinase 2 isoform 1 [Papio anubis] gi|402864486|ref|XP_003896494.1| PREDICTED: SRSF protein kinase 2 isoform 3 [Papio anubis] gi|67967673|dbj|BAE00319.1| unnamed protein product [Macaca fascicularis] gi|355747909|gb|EHH52406.1| hypothetical protein EGM_12841 [Macaca fascicularis] gi|380815900|gb|AFE79824.1| serine/threonine-protein kinase SRPK2 isoform b [Macaca mulatta] gi|383421053|gb|AFH33740.1| serine/threonine-protein kinase SRPK2 isoform b [Macaca mulatta] Back     alignment and taxonomy information
>gi|332868202|ref|XP_003318780.1| PREDICTED: SRSF protein kinase 2 [Pan troglodytes] gi|410213780|gb|JAA04109.1| SRSF protein kinase 2 [Pan troglodytes] gi|410264028|gb|JAA19980.1| SRSF protein kinase 2 [Pan troglodytes] gi|410352601|gb|JAA42904.1| SRSF protein kinase 2 [Pan troglodytes] Back     alignment and taxonomy information
>gi|33188449|ref|NP_872634.1| SRSF protein kinase 2 isoform a [Homo sapiens] gi|119603765|gb|EAW83359.1| SFRS protein kinase 2, isoform CRA_a [Homo sapiens] gi|224487765|dbj|BAH24117.1| SFRS protein kinase 2 [synthetic construct] Back     alignment and taxonomy information
>gi|343961215|dbj|BAK62197.1| serine/threonine-protein kinase SRPK2 [Pan troglodytes] Back     alignment and taxonomy information
>gi|61369026|gb|AAX43273.1| SFRS protein kinase 2 [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query612
RGD|1305107680 Srpk2 "SRSF protein kinase 2" 0.633 0.570 0.386 8.6e-100
UNIPROTKB|E2QTT3686 SRPK2 "Uncharacterized protein 0.633 0.565 0.381 2.6e-98
UNIPROTKB|F1PR36677 SRPK2 "Uncharacterized protein 0.633 0.573 0.381 2.6e-98
UNIPROTKB|F1MNS2687 SRPK2 "Uncharacterized protein 0.544 0.484 0.419 4.2e-98
FB|FBgn0026370764 SRPK "SRPK" [Drosophila melano 0.888 0.712 0.400 2e-97
MGI|MGI:1201408681 Srpk2 "serine/arginine-rich pr 0.882 0.792 0.400 2e-97
UNIPROTKB|B7UCT2655 SRPK1 "SFRS protein kinase 1" 0.772 0.722 0.344 1.6e-96
UNIPROTKB|F6UQU0659 SRPK2 "Uncharacterized protein 0.870 0.808 0.403 1.8e-96
UNIPROTKB|P78362688 SRPK2 "SRSF protein kinase 2" 0.900 0.800 0.392 2.9e-96
UNIPROTKB|F1ND58688 SRPK2 "Uncharacterized protein 0.890 0.792 0.389 1.6e-95
RGD|1305107 Srpk2 "SRSF protein kinase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 689 (247.6 bits), Expect = 8.6e-100, Sum P(2) = 8.6e-100
 Identities = 155/401 (38%), Positives = 228/401 (56%)

Query:    52 PESDQEKM-EDSNDNEESKDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKI 110
             PE ++E +  D  + E+  DY  GGYHPV IGDL+  RY VIRKLGWGHFSTVWLCWD  
Sbjct:    40 PEPEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQ 99

Query:   111 ATRFVALKIMKSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHI 170
               RFVA+K++KSA  YTETA+DEIKLLKCV+E+DP DPN++ +VQL+D+F ISG++G+H+
Sbjct:   100 GKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHV 159

Query:   171 CMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLL 230
             CMV EV G +  K ++KSN +G+P+  VK I++Q+L+ L+YLH+KC IIHTDIKPEN+L+
Sbjct:   160 CMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILM 219

Query:   231 GSNNDHIFELALKTYNQVLKENLPLLHMRNIPSFIQ-KQLN--SNSKDRKMVKYQK---- 283
               +  ++  +A +   +  K   P      + +  Q K +   S +K +K+ K QK    
Sbjct:   220 CVDGAYVRRMAAEA-TEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAE 278

Query:   284 YVEKSLSIIVQSYSNLNRKDGEGTAKETNQIKDERNEKSAEVKEEHPREVIVQVDDLVKD 343
              +EK L  I +      RK  E          ++  E   EVK +         ++  KD
Sbjct:   279 LLEKRLQEIEELEREAERKILEENTTSAEASSEQDGECQPEVKLKEAELEDTTEEETAKD 338

Query:   344 N-ETETSEEKRPLELINNHIDENNQSKDINVLFPNVVGEDKMNIFSDSDGSYVVMRVEAN 402
             N E E  EEK   E  N   DE++  +++  + P  +   K N   ++    +  ++E  
Sbjct:   339 NGEVEDQEEKEDTEKENTEKDEDDVEQELENIDPTWMESPKANGHIENGLFLLEQQLEDE 398

Query:   403 RPTLKDSDTLEPFKLKDTDQLKYNDGKLEADLEELLNKDLP 443
                  D    E + L + +    +D    +  E+  N +LP
Sbjct:   399 EDEEDDCANPEEYNLDEPNA--ESDYTYSSSYEQF-NGELP 436


GO:0000245 "spliceosomal complex assembly" evidence=ISO
GO:0000287 "magnesium ion binding" evidence=ISO
GO:0001525 "angiogenesis" evidence=ISO
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISO
GO:0005524 "ATP binding" evidence=IEA;ISO
GO:0005634 "nucleus" evidence=ISO
GO:0005730 "nucleolus" evidence=ISO
GO:0005737 "cytoplasm" evidence=ISO
GO:0006468 "protein phosphorylation" evidence=ISO
GO:0007243 "intracellular protein kinase cascade" evidence=ISO
GO:0008284 "positive regulation of cell proliferation" evidence=ISO
GO:0008380 "RNA splicing" evidence=ISO
GO:0010628 "positive regulation of gene expression" evidence=ISO
GO:0035063 "nuclear speck organization" evidence=ISO
GO:0043525 "positive regulation of neuron apoptotic process" evidence=ISO
GO:0045070 "positive regulation of viral genome replication" evidence=ISO
GO:0045071 "negative regulation of viral genome replication" evidence=ISO
GO:0045787 "positive regulation of cell cycle" evidence=ISO
GO:0071889 "14-3-3 protein binding" evidence=ISO
UNIPROTKB|E2QTT3 SRPK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PR36 SRPK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNS2 SRPK2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0026370 SRPK "SRPK" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1201408 Srpk2 "serine/arginine-rich protein specific kinase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B7UCT2 SRPK1 "SFRS protein kinase 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6UQU0 SRPK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P78362 SRPK2 "SRSF protein kinase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND58 SRPK2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P78362SRPK2_HUMAN2, ., 7, ., 1, 1, ., 10.37450.85940.7645yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.824
3rd Layer2.7.110.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query612
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 4e-29
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 1e-24
pfam00069260 pfam00069, Pkinase, Protein kinase domain 1e-23
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 1e-19
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 6e-19
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 1e-18
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 7e-18
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 4e-17
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 2e-16
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 2e-16
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 5e-16
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 7e-15
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 8e-14
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-13
PTZ00284467 PTZ00284, PTZ00284, protein kinase; Provisional 4e-13
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 8e-13
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 3e-12
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 4e-12
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 8e-12
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 4e-11
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 5e-11
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 5e-11
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 6e-11
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 1e-10
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 2e-10
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 2e-10
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 3e-10
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 4e-10
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 8e-10
PTZ00284467 PTZ00284, PTZ00284, protein kinase; Provisional 2e-09
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 2e-09
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 2e-09
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 3e-09
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 3e-09
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 4e-09
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 6e-09
pfam00069260 pfam00069, Pkinase, Protein kinase domain 7e-09
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 9e-09
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 9e-09
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 1e-08
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 1e-08
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-08
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 2e-08
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 2e-08
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 3e-08
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 3e-08
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 4e-08
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 5e-08
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 6e-08
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 6e-08
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 7e-08
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 8e-08
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 1e-07
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 1e-07
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 1e-07
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 1e-07
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 1e-07
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 1e-07
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 2e-07
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-07
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 2e-07
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 2e-07
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 4e-07
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 5e-07
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 6e-07
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 7e-07
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 7e-07
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 9e-07
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-06
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 1e-06
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 1e-06
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 1e-06
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 1e-06
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 2e-06
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 3e-06
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-06
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 3e-06
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 3e-06
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 4e-06
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 5e-06
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 5e-06
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 6e-06
cd07851 343 cd07851, STKc_p38, Catalytic domain of the Serine/ 8e-06
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 8e-06
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 8e-06
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 9e-06
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 9e-06
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 1e-05
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 1e-05
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 1e-05
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 1e-05
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-05
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 2e-05
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 2e-05
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 2e-05
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 2e-05
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 3e-05
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 3e-05
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 3e-05
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 3e-05
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 3e-05
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 3e-05
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 4e-05
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 4e-05
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 4e-05
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 4e-05
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 4e-05
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 5e-05
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 5e-05
cd07877 345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 5e-05
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 5e-05
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 5e-05
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 6e-05
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 6e-05
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 6e-05
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 6e-05
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 7e-05
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 7e-05
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 7e-05
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 7e-05
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 8e-05
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 8e-05
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 8e-05
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 8e-05
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 9e-05
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 9e-05
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 9e-05
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 1e-04
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 1e-04
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 1e-04
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 1e-04
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 1e-04
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 1e-04
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-04
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 2e-04
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 2e-04
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 2e-04
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-04
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 2e-04
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 2e-04
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 2e-04
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 3e-04
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 3e-04
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 3e-04
cd07850 353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 3e-04
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 3e-04
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 3e-04
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 4e-04
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 4e-04
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 4e-04
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 4e-04
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 5e-04
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 5e-04
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 6e-04
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 6e-04
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 6e-04
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 6e-04
cd07876 359 cd07876, STKc_JNK2, Catalytic domain of the Serine 6e-04
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 7e-04
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 7e-04
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 8e-04
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 8e-04
cd07853 372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 9e-04
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 0.001
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 0.001
cd07875 364 cd07875, STKc_JNK1, Catalytic domain of the Serine 0.001
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 0.001
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 0.001
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 0.001
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 0.001
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 0.001
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 0.001
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 0.002
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 0.002
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 0.002
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 0.002
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 0.002
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 0.002
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 0.002
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 0.002
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 0.002
PHA02882294 PHA02882, PHA02882, putative serine/threonine kina 0.002
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 0.002
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 0.002
PHA03210501 PHA03210, PHA03210, serine/threonine kinase US3; P 0.002
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 0.002
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 0.002
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 0.003
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 0.003
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 0.003
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 0.003
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 0.003
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 0.003
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 0.003
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 0.003
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 0.003
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 0.004
PLN03225566 PLN03225, PLN03225, Serine/threonine-protein kinas 0.004
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 0.004
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 0.004
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
 Score =  116 bits (292), Expect = 4e-29
 Identities = 51/149 (34%), Positives = 79/149 (53%), Gaps = 18/149 (12%)

Query: 89  YFVIRKLGWGHFSTVWLCWDKIATRFVALKIMK--SAPQYTETAIDEIKLLKCVQETDPQ 146
           Y ++ KLG G F  V+L  DK   + VA+K++K     +  E  + EIK+LK ++     
Sbjct: 1   YEILEKLGEGSFGKVYLARDKKTGKLVAIKVIKKKKIKKDRERILREIKILKKLKH---- 56

Query: 147 DPNREKIVQLLDNFTISGVHGVHICMVLE-VEGFNTYKLLLKSNNKGIPLYNVKCIVKQL 205
            PN   IV+L D F         + +V+E  EG + + LL       +     +  ++Q+
Sbjct: 57  -PN---IVRLYDVF----EDEDKLYLVMEYCEGGDLFDLL--KKRGRLSEDEARFYLRQI 106

Query: 206 LEALEYLHNKCNIIHTDIKPENVLLGSNN 234
           L ALEYLH+K  I+H D+KPEN+LL  + 
Sbjct: 107 LSALEYLHSK-GIVHRDLKPENILLDEDG 134


Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254

>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|165211 PHA02882, PHA02882, putative serine/threonine kinase; Provisional Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 612
KOG1290|consensus590 100.0
KOG0595|consensus429 100.0
KOG0667|consensus586 100.0
KOG0598|consensus357 100.0
KOG0593|consensus396 100.0
KOG0659|consensus318 100.0
KOG0615|consensus475 100.0
KOG0661|consensus538 100.0
KOG0663|consensus419 100.0
KOG0600|consensus560 100.0
KOG0575|consensus592 100.0
KOG0616|consensus355 100.0
KOG0605|consensus550 100.0
KOG0603|consensus612 100.0
KOG0594|consensus323 100.0
KOG0581|consensus364 100.0
KOG0583|consensus370 100.0
KOG0660|consensus359 100.0
KOG0694|consensus694 100.0
KOG0658|consensus364 100.0
KOG0592|consensus604 100.0
KOG0671|consensus415 100.0
KOG0591|consensus375 100.0
KOG0588|consensus 786 100.0
KOG0611|consensus 668 100.0
KOG0597|consensus 808 100.0
PTZ00284467 protein kinase; Provisional 100.0
KOG0585|consensus576 100.0
KOG0610|consensus459 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
KOG0033|consensus355 100.0
KOG0032|consensus382 100.0
KOG0662|consensus292 100.0
KOG0670|consensus752 100.0
KOG0198|consensus313 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
KOG4250|consensus 732 100.0
KOG0578|consensus550 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
KOG0666|consensus438 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
KOG0580|consensus281 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
KOG0192|consensus362 100.0
KOG0690|consensus516 100.0
KOG4717|consensus 864 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
KOG0607|consensus463 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
KOG0604|consensus400 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
KOG0612|consensus 1317 100.0
KOG4236|consensus888 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
KOG0599|consensus411 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
KOG0201|consensus467 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
KOG0586|consensus596 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
KOG0589|consensus426 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
KOG0582|consensus516 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
KOG0614|consensus732 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
KOG0986|consensus591 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
KOG0696|consensus683 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
PTZ00283496 serine/threonine protein kinase; Provisional 100.0
KOG0596|consensus677 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
KOG0574|consensus502 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.98
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.98
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.98
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.98
KOG1187|consensus361 99.98
KOG1989|consensus 738 99.98
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.98
KOG4279|consensus 1226 99.98
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.98
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.98
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.98
PHA03211461 serine/threonine kinase US3; Provisional 99.98
KOG0695|consensus593 99.98
KOG0579|consensus 1187 99.97
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.97
KOG0608|consensus1034 99.97
KOG0983|consensus391 99.97
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.97
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.97
KOG0197|consensus468 99.97
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.97
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.97
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.97
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.97
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.97
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.97
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.97
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.97
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.97
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.97
KOG0984|consensus282 99.97
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.97
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.97
KOG4645|consensus1509 99.97
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.97
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.97
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.97
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.97
KOG4721|consensus 904 99.97
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.97
KOG1151|consensus775 99.97
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.97
PHA03210501 serine/threonine kinase US3; Provisional 99.97
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.97
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.97
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.97
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.97
PHA02882294 putative serine/threonine kinase; Provisional 99.97
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.97
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.97
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.97
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.97
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.97
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.97
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.97
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.97
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.97
KOG0193|consensus678 99.97
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.97
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.97
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.97
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.97
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.97
KOG0669|consensus376 99.97
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.97
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.97
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.97
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.97
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.97
KOG1152|consensus772 99.97
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.97
PLN00009294 cyclin-dependent kinase A; Provisional 99.97
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.97
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.97
PHA02988283 hypothetical protein; Provisional 99.97
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.97
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.97
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.97
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.97
KOG1006|consensus361 99.97
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.97
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.97
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.97
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.97
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.97
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.97
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.97
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.97
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.97
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.97
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.97
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.97
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.97
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.97
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.97
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.97
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.97
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.97
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.97
KOG0577|consensus 948 99.97
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.97
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.97
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.97
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.97
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.97
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.97
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.97
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.97
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.97
KOG2345|consensus302 99.97
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.97
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.97
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.97
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.97
KOG1035|consensus 1351 99.97
KOG0664|consensus449 99.97
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.97
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.97
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.97
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.97
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.97
KOG0576|consensus 829 99.97
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.97
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.97
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.97
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.97
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.97
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.97
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.97
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.97
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.97
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.97
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.97
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.97
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.97
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.97
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.97
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.97
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.97
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.97
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.97
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.97
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.97
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.97
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.97
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.97
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.97
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.97
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.97
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.97
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.97
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.97
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.97
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.97
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.97
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.97
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.97
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.97
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.97
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.97
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.97
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.97
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.97
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.97
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.97
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.97
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.97
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.97
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.97
KOG0584|consensus632 99.97
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.97
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.97
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.97
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.96
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.96
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.96
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.96
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.96
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.96
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.96
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.96
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.96
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.96
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.96
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.96
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.96
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.96
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.96
KOG0590|consensus601 99.96
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.96
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.96
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.96
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.96
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.96
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.96
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.96
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.96
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.96
KOG0668|consensus338 99.96
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.96
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.96
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.96
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.96
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.96
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.96
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.96
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.96
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.96
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.96
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.96
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.96
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.96
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.96
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.96
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.96
KOG0587|consensus 953 99.96
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.96
KOG0603|consensus612 99.96
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.96
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.96
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.96
KOG0665|consensus369 99.96
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.96
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.96
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.96
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.96
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.96
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.96
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.96
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.96
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.96
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.96
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.96
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.96
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.96
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.96
KOG0194|consensus474 99.96
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.96
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.96
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.96
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.96
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.96
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.96
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.96
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.96
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.96
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.96
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.95
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.95
KOG2052|consensus513 99.95
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.95
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.95
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.95
KOG1026|consensus774 99.94
KOG3653|consensus534 99.94
KOG1095|consensus1025 99.94
PLN03224507 probable serine/threonine protein kinase; Provisio 99.94
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.94
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.93
KOG0616|consensus355 99.93
KOG1345|consensus378 99.93
KOG0598|consensus357 99.93
KOG1167|consensus418 99.93
KOG1027|consensus903 99.93
KOG4257|consensus974 99.93
KOG0199|consensus 1039 99.92
KOG1094|consensus807 99.92
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.92
KOG0595|consensus 429 99.92
KOG4278|consensus 1157 99.91
KOG0694|consensus694 99.91
KOG1164|consensus322 99.91
KOG0592|consensus 604 99.91
KOG0196|consensus996 99.91
KOG0575|consensus 592 99.91
PRK09188365 serine/threonine protein kinase; Provisional 99.9
KOG0581|consensus364 99.9
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.89
KOG1163|consensus341 99.89
KOG0615|consensus475 99.89
KOG1025|consensus1177 99.88
KOG0591|consensus 375 99.88
KOG0583|consensus 370 99.88
KOG0200|consensus609 99.88
KOG1165|consensus449 99.88
KOG0588|consensus 786 99.87
KOG0578|consensus550 99.87
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.86
PLN00181 793 protein SPA1-RELATED; Provisional 99.85
KOG0599|consensus 411 99.85
KOG0696|consensus 683 99.85
KOG0033|consensus 355 99.85
KOG0614|consensus732 99.84
KOG0690|consensus 516 99.84
KOG0597|consensus 808 99.84
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.84
KOG1035|consensus 1351 99.84
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.83
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.83
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.83
KOG0986|consensus 591 99.83
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.83
KOG0192|consensus362 99.83
KOG4721|consensus 904 99.83
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.82
PTZ00036 440 glycogen synthase kinase; Provisional 99.82
KOG0611|consensus 668 99.82
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.82
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.82
KOG0604|consensus 400 99.82
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.82
KOG0589|consensus 426 99.82
KOG0032|consensus 382 99.82
PHA03212391 serine/threonine kinase US3; Provisional 99.82
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.82
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.82
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.81
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.81
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.81
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.81
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.81
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.81
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.81
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.81
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.81
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.81
KOG0585|consensus 576 99.81
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.8
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.8
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.8
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.8
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.8
KOG0198|consensus313 99.8
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.8
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.8
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.8
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.8
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.8
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.8
PRK10345210 hypothetical protein; Provisional 99.8
KOG0612|consensus 1317 99.8
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.8
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.8
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.8
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.8
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.8
PHA03207392 serine/threonine kinase US3; Provisional 99.8
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.8
KOG0695|consensus 593 99.79
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.79
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.79
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.79
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.79
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.79
KOG0580|consensus281 99.79
KOG0601|consensus524 99.79
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.79
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.79
PRK12274218 serine/threonine protein kinase; Provisional 99.79
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.79
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.79
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.79
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.79
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.79
KOG0201|consensus 467 99.79
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.79
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.78
>KOG1290|consensus Back     alignment and domain information
Probab=100.00  E-value=9.6e-56  Score=458.03  Aligned_cols=175  Identities=59%  Similarity=1.026  Sum_probs=166.5

Q ss_pred             CCCCCcccccCcCCCCceecCCCCccc-cceeEEEEecccCceEEEEEEEccCCeEEEEEEecCCchhhHHHHHHHHHHH
Q psy13755         60 EDSNDNEESKDYRVGGYHPVNIGDLYE-QRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEIKLLK  138 (612)
Q Consensus        60 ~~~~~~~~~~~~~~~~~~~~~~g~~~~-~~y~i~~~LG~G~fG~Vy~a~~~~~~~~vAiK~i~~~~~~~~~~~~Ei~il~  138 (612)
                      ++++++|...+|+.|||+|+.+|+.|. +||.+.++||.|-|++||+|.+....++||+|+++....+.+..+.||++|+
T Consensus        50 ~~~~eqE~~~dY~kGGYHpV~IGD~F~~gRY~v~rKLGWGHFSTVWLawDtq~~r~VAlKVvKSAqhYtEaAlDEIklL~  129 (590)
T KOG1290|consen   50 SDDEEQEDPEDYRKGGYHPVRIGDVFNGGRYHVQRKLGWGHFSTVWLAWDTQNKRYVALKVVKSAQHYTEAALDEIKLLQ  129 (590)
T ss_pred             CCcccccChhhhhcCCCceeeccccccCceEEEEEeccccccceeEEEeeccCCeEEEEEEEehhhHHHHHHHHHHHHHH
Confidence            344566778899999999999999998 9999999999999999999999999999999999998899999999999999


Q ss_pred             HhhccCCCCCccccceeeccceeecCccceEEEEEEeecCCCcHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHHhCCCc
Q psy13755        139 CVQETDPQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNI  218 (612)
Q Consensus       139 ~L~h~~~~~p~h~~Iv~l~~~~~~~~~~~~~~~lVmE~~~~~~l~~l~~~~~~~l~~~~~~~i~~Qil~aL~yLH~~~gI  218 (612)
                      +++...+++++..+||+|+|.|...++++.|+|||+|+++..+|..+.....++++...++.|++|||.||.|||.+|||
T Consensus       130 ~v~~~Dp~~~~~~~VV~LlD~FkhsGpNG~HVCMVfEvLGdnLLklI~~s~YrGlpl~~VK~I~~qvL~GLdYLH~ecgI  209 (590)
T KOG1290|consen  130 QVREGDPNDPGKKCVVQLLDHFKHSGPNGQHVCMVFEVLGDNLLKLIKYSNYRGLPLSCVKEICRQVLTGLDYLHRECGI  209 (590)
T ss_pred             HHHhcCCCCCCCceeeeeeccceecCCCCcEEEEEehhhhhHHHHHHHHhCCCCCcHHHHHHHHHHHHHHHHHHHHhcCc
Confidence            99999989999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCCCCCCEEEecCC
Q psy13755        219 IHTDIKPENVLLGSNN  234 (612)
Q Consensus       219 IHRDLKPeNILl~~~~  234 (612)
                      ||-||||+|||+..+.
T Consensus       210 IHTDlKPENvLl~~~e  225 (590)
T KOG1290|consen  210 IHTDLKPENVLLCSTE  225 (590)
T ss_pred             cccCCCcceeeeeccc
Confidence            9999999999998763



>KOG0595|consensus Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query612
2x7g_A389 Structure Of Human Serine-Arginine-Rich Protein-Spe 4e-65
2x7g_A389 Structure Of Human Serine-Arginine-Rich Protein-Spe 1e-30
1wbp_A397 Srpk1 Bound To 9mer Docking Motif Peptide Length = 5e-63
1wbp_A397 Srpk1 Bound To 9mer Docking Motif Peptide Length = 4e-32
3beg_A381 Crystal Structure Of Sr Protein Kinase 1 Complexed 8e-61
3beg_A381 Crystal Structure Of Sr Protein Kinase 1 Complexed 6e-32
1q8y_A373 The Structure Of The Yeast Sr Protein Kinase, Sky1p 2e-40
1q8y_A 373 The Structure Of The Yeast Sr Protein Kinase, Sky1p 4e-23
1how_A373 The X-Ray Crystal Structure Of Sky1p, An Sr Protein 5e-40
1how_A 373 The X-Ray Crystal Structure Of Sky1p, An Sr Protein 4e-23
3nr9_A368 Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length 8e-19
3nr9_A368 Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length 1e-09
2wu6_A381 Crystal Structure Of The Human Clk3 In Complex With 3e-18
2wu6_A381 Crystal Structure Of The Human Clk3 In Complex With 1e-08
2exe_A357 Crystal Structure Of The Phosphorylated Clk3 Length 4e-18
2exe_A357 Crystal Structure Of The Phosphorylated Clk3 Length 1e-08
2eu9_A355 Crystal Structure Of Clk3 Length = 355 5e-18
2eu9_A355 Crystal Structure Of Clk3 Length = 355 1e-08
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 5e-17
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 2e-09
2vag_A339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 6e-17
2vag_A339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 1e-08
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 7e-16
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 7e-07
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 7e-16
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 6e-07
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 8e-16
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 8e-07
3anq_A368 Human Dyrk1aINHIBITOR COMPLEX Length = 368 9e-14
3anq_A368 Human Dyrk1aINHIBITOR COMPLEX Length = 368 6e-09
2vx3_A382 Crystal Structure Of The Human Dual Specificity Tyr 1e-13
2vx3_A382 Crystal Structure Of The Human Dual Specificity Tyr 5e-09
4aze_A382 Human Dyrk1a In Complex With Leucettine L41 Length 1e-13
4aze_A382 Human Dyrk1a In Complex With Leucettine L41 Length 6e-09
3llt_A360 Crystal Structure Of Pf14_0431, Kinase Domain Lengt 2e-13
3llt_A360 Crystal Structure Of Pf14_0431, Kinase Domain Lengt 4e-10
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 8e-10
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 7e-04
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-09
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-04
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-09
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 8e-04
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-09
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 1e-08
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 2e-08
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 2e-08
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 3e-08
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 4e-08
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 7e-08
3uys_A296 Crystal Structure Of Apo Human Ck1d Length = 296 8e-08
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 9e-08
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 9e-08
1ckj_A317 Casein Kinase I Delta Truncation Mutant Containing 1e-07
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-07
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-07
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-07
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 2e-07
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 2e-07
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 2e-07
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 4e-07
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 4e-07
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 5e-07
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 5e-07
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 6e-07
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 7e-07
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 7e-07
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 9e-07
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 1e-06
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 1e-06
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 1e-06
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 1e-06
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-06
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 1e-06
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 1e-06
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 1e-06
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 1e-06
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 1e-06
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 1e-06
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-06
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 2e-06
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 2e-06
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 2e-06
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 2e-06
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 2e-06
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 2e-06
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 2e-06
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 2e-06
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 2e-06
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 2e-06
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 2e-06
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 2e-06
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 2e-06
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 2e-06
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 2e-06
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 2e-06
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 2e-06
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 3e-06
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 3e-06
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 3e-06
4e5a_X 360 The W197a Mutant Of P38a Map Kinase Length = 360 6e-06
4hni_A296 Crystal Structure Of Ck1e In Complex With Pf4800567 6e-06
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 6e-06
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 6e-06
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 6e-06
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 9e-06
3v3v_A 379 Structural And Functional Analysis Of Quercetagetin 9e-06
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 9e-06
3nnx_A 354 Crystal Structure Of Phosphorylated P38 Alpha In Co 9e-06
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 1e-05
3d83_A 360 Crystal Structure Of P38 Kinase In Complex With A B 1e-05
3e92_A 371 Crystal Structure Of P38 Kinase In Complex With A B 1e-05
2y8o_A 362 Crystal Structure Of Human P38alpha Complexed With 1e-05
1ove_A 366 The Structure Of P38 Alpha In Complex With A Dihydr 1e-05
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 1e-05
3dt1_A 383 P38 Complexed With A Quinazoline Inhibitor Length = 1e-05
2bal_A 365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 1e-05
3hvc_A 362 Crystal Structure Of Human P38alpha Map Kinase Leng 1e-05
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 1e-05
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 1e-05
1ywr_A 360 Crystal Structure Analysis Of Inactive P38 Kinase D 1e-05
3d7z_A 360 Crystal Structure Of P38 Kinase In Complex With A B 1e-05
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 1e-05
3mpt_A 371 Crystal Structure Of P38 Kinase In Complex With A P 1e-05
2baq_A 365 P38alpha Bound To Ro3201195 Length = 365 1e-05
3ody_X 360 Crystal Structure Of P38alpha Y323q Active Mutant L 1e-05
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-05
1yw2_A 360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 1e-05
3kq7_A 380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 1e-05
3gcu_A 360 Human P38 Map Kinase In Complex With Rl48 Length = 1e-05
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 1e-05
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 1e-05
3od6_X 360 Crystal Structure Of P38alpha Y323t Active Mutant L 1e-05
3fi4_A 372 P38 Kinase Crystal Structure In Complex With Ro4499 1e-05
3k3j_A 362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 1e-05
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 1e-05
1bl6_A 379 The Complex Structure Of The Map Kinase P38SB216995 1e-05
2cmw_A310 Structure Of Human Casein Kinase 1 Gamma-1 In Compl 1e-05
1bmk_A 379 The Complex Structure Of The Map Kinase P38SB218655 1e-05
1m7q_A 366 Crystal Structure Of P38 Map Kinase In Complex With 1e-05
3zsg_A 362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 1e-05
3py3_A 380 Crystal Structure Of Phosphorylated P38alpha Map Ki 1e-05
3odz_X 360 Crystal Structure Of P38alpha Y323r Active Mutant L 1e-05
3nnu_A 354 Crystal Structure Of P38 Alpha In Complex With Dp13 1e-05
2baj_A 365 P38alpha Bound To Pyrazolourea Length = 365 1e-05
1ian_A 366 Human P38 Map Kinase Inhibitor Complex Length = 366 1e-05
3tg1_A 380 Crystal Structure Of P38alpha In Complex With A Map 1e-05
3hrb_A 359 P38 Kinase Crystal Structure In Complex With Small 1e-05
2npq_A 367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 1e-05
1lew_A 360 Crystal Structure Of Map Kinase P38 Complexed To Th 1e-05
3oef_X 360 Crystal Structure Of Y323f Inactive Mutant Of P38al 1e-05
1oz1_A 372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 1e-05
3p4k_A 370 The Third Conformation Of P38a Map Kinase Observed 1e-05
2oza_B 366 Structure Of P38alpha Complex Length = 366 1e-05
2gfs_A 372 P38 Kinase Crystal Structure In Complex With Ro3201 1e-05
1di9_A 360 The Structure Of P38 Mitogen-Activated Protein Kina 1e-05
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 1e-05
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 2e-05
2gtm_A 348 Mutated Mouse P38 Map Kinase Domain In Complex With 2e-05
3hec_A 348 P38 In Complex With Imatinib Length = 348 2e-05
2ghl_A 348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 2e-05
2lgc_A 359 Joint Nmr And X-Ray Refinement Reveals The Structur 2e-05
3s3i_A 349 P38 Kinase Crystal Structure In Complex With Small 2e-05
1zzl_A 351 Crystal Structure Of P38 With Triazolopyridine Leng 2e-05
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 2e-05
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 2e-05
3k3i_A 350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 2e-05
2izr_A330 Structure Of Casein Kinase Gamma 3 In Complex With 2e-05
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 2e-05
3o17_A 370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 2e-04
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 2e-05
2chl_A351 Structure Of Casein Kinase 1 Gamma 3 Length = 351 2e-05
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 2e-05
2g01_A 370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 4e-04
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 2e-05
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-05
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 2e-05
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 2e-05
2puu_A 348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 2e-05
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 2e-05
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 2e-05
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 2e-05
3vuh_A 370 Crystal Structure Of A Cysteine-deficient Mutant M3 3e-05
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 2e-05
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 2e-05
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 2e-05
3a7f_A303 Human Mst3 Kinase Length = 303 2e-05
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 2e-05
3vud_A 370 Crystal Structure Of A Cysteine-deficient Mutant M1 3e-05
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-05
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-05
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 2e-05
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 2e-05
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 2e-05
2xs0_A 386 Linear Binding Motifs For Jnk And For Calcineurin A 5e-05
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 2e-05
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 2e-05
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 2e-05
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 2e-05
4ewq_A 383 Human P38 Alpha Mapk In Complex With A Pyridazine B 2e-05
3vuk_A 370 Crystal Structure Of A Cysteine-deficient Mutant M5 2e-05
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 2e-05
3elj_A 369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 7e-04
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 2e-05
3vug_A 370 Crystal Structure Of A Cysteine-deficient Mutant M2 3e-05
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 2e-05
1ukh_A 369 Structural Basis For The Selective Inhibition Of Jn 3e-05
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 2e-05
2xrw_A 371 Linear Binding Motifs For Jnk And For Calcineurin A 3e-05
3vui_A 370 Crystal Structure Of A Cysteine-deficient Mutant M2 2e-05
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 2e-05
3mh2_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-05
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 2e-05
3oht_A 389 Crystal Structure Of Salmo Salar P38alpha Length = 3e-05
3mh0_A 360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 3e-05
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 3e-05
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 3e-05
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 3e-05
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 3e-05
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 3e-05
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 3e-05
4exu_A371 Mapk13, Inactive Form Length = 371 3e-05
3e7o_A 360 Crystal Structure Of Jnk2 Length = 360 4e-05
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 4e-05
3mh3_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 4e-05
4hgl_A330 Crystal Structure Of Ck1g3 With Compound 1 Length = 4e-05
3mh1_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 4e-05
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 5e-05
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 5e-05
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 5e-05
3gcp_A 360 Human P38 Map Kinase In Complex With Sb203580 Lengt 5e-05
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 5e-05
3pze_A 358 Jnk1 In Complex With Inhibitor Length = 358 7e-04
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 6e-05
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 6e-05
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 6e-05
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 7e-05
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 7e-05
3o8p_A 360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 7e-05
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 7e-05
1cm8_A 367 Phosphorylated Map Kinase P38-Gamma Length = 367 8e-05
2fst_X 367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 8e-05
3npc_A 364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 8e-05
2fso_X 367 Mitogen Activated Protein Kinase P38alpha (D176a) A 9e-05
2fsl_X 367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 9e-05
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 1e-04
3kvx_A 364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 3e-04
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 1e-04
3ttj_A 464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 5e-04
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 1e-04
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 1e-04
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 1e-04
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 1e-04
3gc9_A 370 The Structure Of P38beta C119s, C162s In Complex Wi 1e-04
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 1e-04
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-04
3gc8_A 370 The Structure Of P38beta C162s In Complex With A Di 1e-04
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-04
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 1e-04
2r9s_A 356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 4e-04
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 1e-04
1jnk_A 423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 4e-04
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 1e-04
3oxi_A 362 Design And Synthesis Of Disubstituted Thiophene And 4e-04
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 1e-04
2o0u_A 364 Crystal Structure Of Human Jnk3 Complexed With N-{3 4e-04
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 1e-04
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 2e-04
2ok1_A 365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 4e-04
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 2e-04
3ptg_A 363 Design And Synthesis Of A Novel, Orally Efficacious 4e-04
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 2e-04
1pmn_A 364 Crystal Structure Of Jnk3 In Complex With An Imidaz 4e-04
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 2e-04
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 4e-04
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 2e-04
2exc_X 356 Inhibitor Complex Of Jnk3 Length = 356 5e-04
3gi3_A 360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 2e-04
3sv0_A483 Crystal Structure Of Casein Kinase-1 Like Protein I 2e-04
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 2e-04
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 2e-04
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 2e-04
4h36_A 356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 4e-04
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 2e-04
2b1p_A 355 Inhibitor Complex Of Jnk3 Length = 355 4e-04
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 2e-04
3vum_A 370 Crystal Structure Of A Cysteine-deficient Mutant M7 3e-04
3vul_A 370 Crystal Structure Of A Cysteine-deficient Mutant M1 3e-04
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 3e-04
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 3e-04
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 3e-04
3fi3_A 364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 3e-04
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 3e-04
2c47_A313 Structure Of Casein Kinase 1 Gamma 2 Length = 313 3e-04
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 4e-04
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 4e-04
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 4e-04
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 4e-04
2zoq_A 382 Structural Dissection Of Human Mitogen-Activated Ki 4e-04
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 5e-04
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 5e-04
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 5e-04
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 5e-04
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 5e-04
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 6e-04
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 6e-04
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 6e-04
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 6e-04
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 7e-04
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 7e-04
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 7e-04
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 7e-04
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 7e-04
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 7e-04
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 7e-04
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 7e-04
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 7e-04
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 7e-04
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 7e-04
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 7e-04
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 7e-04
3oz6_A388 Crystal Structure Of Mapk From Cryptosporidium Parv 7e-04
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 7e-04
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 7e-04
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 7e-04
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 7e-04
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 8e-04
1tvo_A 368 The Structure Of Erk2 In Complex With A Small Molec 8e-04
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 8e-04
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 8e-04
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 8e-04
>pdb|2X7G|A Chain A, Structure Of Human Serine-Arginine-Rich Protein-Specific Kinase 2 (Srpk2) Bound To Purvalanol B Length = 389 Back     alignment and structure

Iteration: 1

Score = 245 bits (626), Expect = 4e-65, Method: Compositional matrix adjust. Identities = 107/181 (59%), Positives = 144/181 (79%) Query: 61 DSNDNEESKDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIM 120 D + E+ DY GGYHPV IGDL+ RY VIRKLGWGHFSTVWLCWD RFVA+K++ Sbjct: 5 DDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVV 64 Query: 121 KSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFN 180 KSA YTETA+DEIKLLKCV+E+DP DPN++ +VQL+D+F ISG++G+H+CMV EV G + Sbjct: 65 KSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHH 124 Query: 181 TYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFEL 240 K ++KSN +G+P+ VK I++Q+L+ L+YLH+KC IIHTDIKPEN+L+ ++ ++ + Sbjct: 125 LLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRM 184 Query: 241 A 241 A Sbjct: 185 A 185
>pdb|2X7G|A Chain A, Structure Of Human Serine-Arginine-Rich Protein-Specific Kinase 2 (Srpk2) Bound To Purvalanol B Length = 389 Back     alignment and structure
>pdb|1WBP|A Chain A, Srpk1 Bound To 9mer Docking Motif Peptide Length = 397 Back     alignment and structure
>pdb|1WBP|A Chain A, Srpk1 Bound To 9mer Docking Motif Peptide Length = 397 Back     alignment and structure
>pdb|3BEG|A Chain A, Crystal Structure Of Sr Protein Kinase 1 Complexed To Its Substrate AsfSF2 Length = 381 Back     alignment and structure
>pdb|3BEG|A Chain A, Crystal Structure Of Sr Protein Kinase 1 Complexed To Its Substrate AsfSF2 Length = 381 Back     alignment and structure
>pdb|1Q8Y|A Chain A, The Structure Of The Yeast Sr Protein Kinase, Sky1p, With Bound Adp Length = 373 Back     alignment and structure
>pdb|1Q8Y|A Chain A, The Structure Of The Yeast Sr Protein Kinase, Sky1p, With Bound Adp Length = 373 Back     alignment and structure
>pdb|1HOW|A Chain A, The X-Ray Crystal Structure Of Sky1p, An Sr Protein Kinase In Yeast Length = 373 Back     alignment and structure
>pdb|1HOW|A Chain A, The X-Ray Crystal Structure Of Sky1p, An Sr Protein Kinase In Yeast Length = 373 Back     alignment and structure
>pdb|3NR9|A Chain A, Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length = 368 Back     alignment and structure
>pdb|3NR9|A Chain A, Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length = 368 Back     alignment and structure
>pdb|2WU6|A Chain A, Crystal Structure Of The Human Clk3 In Complex With Dki Length = 381 Back     alignment and structure
>pdb|2WU6|A Chain A, Crystal Structure Of The Human Clk3 In Complex With Dki Length = 381 Back     alignment and structure
>pdb|2EXE|A Chain A, Crystal Structure Of The Phosphorylated Clk3 Length = 357 Back     alignment and structure
>pdb|2EXE|A Chain A, Crystal Structure Of The Phosphorylated Clk3 Length = 357 Back     alignment and structure
>pdb|2EU9|A Chain A, Crystal Structure Of Clk3 Length = 355 Back     alignment and structure
>pdb|2EU9|A Chain A, Crystal Structure Of Clk3 Length = 355 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|3ANQ|A Chain A, Human Dyrk1aINHIBITOR COMPLEX Length = 368 Back     alignment and structure
>pdb|3ANQ|A Chain A, Human Dyrk1aINHIBITOR COMPLEX Length = 368 Back     alignment and structure
>pdb|2VX3|A Chain A, Crystal Structure Of The Human Dual Specificity Tyrosine- Phosphorylation-Regulated Kinase 1a Length = 382 Back     alignment and structure
>pdb|2VX3|A Chain A, Crystal Structure Of The Human Dual Specificity Tyrosine- Phosphorylation-Regulated Kinase 1a Length = 382 Back     alignment and structure
>pdb|4AZE|A Chain A, Human Dyrk1a In Complex With Leucettine L41 Length = 382 Back     alignment and structure
>pdb|4AZE|A Chain A, Human Dyrk1a In Complex With Leucettine L41 Length = 382 Back     alignment and structure
>pdb|3LLT|A Chain A, Crystal Structure Of Pf14_0431, Kinase Domain Length = 360 Back     alignment and structure
>pdb|3LLT|A Chain A, Crystal Structure Of Pf14_0431, Kinase Domain Length = 360 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3UYS|A Chain A, Crystal Structure Of Apo Human Ck1d Length = 296 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|1CKJ|A Chain A, Casein Kinase I Delta Truncation Mutant Containing Residues 1-317 Complex With Bound Tungstate Length = 317 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|4HNI|A Chain A, Crystal Structure Of Ck1e In Complex With Pf4800567 Length = 296 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|2CMW|A Chain A, Structure Of Human Casein Kinase 1 Gamma-1 In Complex With 2-(2-Hydroxyethylamino)-6-(3-Chloroanilino)-9- Isopropylpurine (Casp Target) Length = 310 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|2IZR|A Chain A, Structure Of Casein Kinase Gamma 3 In Complex With Inhibitor Length = 330 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|2CHL|A Chain A, Structure Of Casein Kinase 1 Gamma 3 Length = 351 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|4HGL|A Chain A, Crystal Structure Of Ck1g3 With Compound 1 Length = 330 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In Plant Length = 483 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|2C47|A Chain A, Structure Of Casein Kinase 1 Gamma 2 Length = 313 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query612
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 3e-77
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 1e-31
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 2e-68
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 4e-32
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 4e-49
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 3e-22
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 8e-43
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 7e-20
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 9e-43
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 2e-20
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 8e-42
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 3e-17
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 4e-41
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 3e-18
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 4e-24
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-06
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 2e-22
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 2e-22
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 8e-04
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 7e-22
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-06
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 1e-21
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 8e-06
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-21
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 3e-21
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 9e-08
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 3e-21
2a19_B284 Interferon-induced, double-stranded RNA-activated 7e-21
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-05
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-20
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 2e-20
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 2e-06
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-20
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 4e-20
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 4e-08
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-20
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 4e-07
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 1e-19
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 5e-07
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 3e-19
3o0g_A292 Cell division protein kinase 5; kinase activator c 4e-19
3o0g_A292 Cell division protein kinase 5; kinase activator c 3e-06
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 1e-18
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 7e-04
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 1e-18
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-18
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-06
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-18
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 1e-18
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 2e-07
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 2e-18
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 2e-07
3ork_A311 Serine/threonine protein kinase; structural genomi 2e-18
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-18
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-05
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 3e-18
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 3e-18
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 3e-08
3niz_A311 Rhodanese family protein; structural genomics, str 4e-18
3niz_A311 Rhodanese family protein; structural genomics, str 4e-07
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 5e-18
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 7e-18
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 1e-17
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 1e-17
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-17
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 2e-17
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 2e-17
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 2e-17
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 3e-08
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-17
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 2e-17
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 3e-17
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 3e-17
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 5e-17
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 5e-17
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 5e-17
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 6e-17
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 7e-17
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 8e-17
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 9e-17
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 3e-07
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 9e-17
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 9e-17
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 9e-17
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 2e-07
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 1e-16
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-16
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 1e-16
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 1e-16
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-16
3bhy_A283 Death-associated protein kinase 3; death associate 2e-16
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 2e-16
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 3e-16
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 7e-07
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 3e-16
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-04
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 3e-16
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 5e-04
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 4e-16
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 7e-16
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 7e-16
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 8e-04
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 9e-16
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 1e-08
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 1e-15
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 1e-15
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 2e-15
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 2e-15
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 2e-15
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-15
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 2e-15
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-06
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 3e-15
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-15
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 3e-15
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 7e-04
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 4e-15
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 4e-15
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 4e-15
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 5e-15
3lij_A494 Calcium/calmodulin dependent protein kinase with A 6e-15
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 6e-15
3eqc_A360 Dual specificity mitogen-activated protein kinase; 6e-15
3eqc_A360 Dual specificity mitogen-activated protein kinase; 1e-05
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 7e-15
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 8e-15
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-14
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-09
3uqc_A286 Probable conserved transmembrane protein; structur 1e-14
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 1e-14
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 2e-05
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-14
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 4e-14
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 4e-14
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 3e-07
3an0_A340 Dual specificity mitogen-activated protein kinase; 5e-14
3fme_A290 Dual specificity mitogen-activated protein kinase; 6e-14
3fme_A290 Dual specificity mitogen-activated protein kinase; 6e-04
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 6e-14
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 4e-05
3aln_A327 Dual specificity mitogen-activated protein kinase; 6e-14
3aln_A327 Dual specificity mitogen-activated protein kinase; 8e-04
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 1e-13
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 1e-13
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 1e-13
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 2e-06
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-13
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-04
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 2e-13
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 3e-13
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 1e-04
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 3e-13
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 3e-13
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 4e-13
3dls_A335 PAS domain-containing serine/threonine-protein KI; 4e-13
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 5e-13
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 2e-05
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 7e-13
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-12
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 1e-12
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 9e-06
2fst_X367 Mitogen-activated protein kinase 14; active mutant 1e-12
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 1e-06
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 2e-12
3rp9_A458 Mitogen-activated protein kinase; structural genom 2e-12
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 4e-12
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 2e-04
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 7e-12
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 3e-06
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 8e-12
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 7e-04
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 1e-11
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 1e-11
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 2e-04
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 1e-11
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 7e-07
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 1e-11
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 2e-11
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 3e-07
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 2e-11
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 3e-04
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-11
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 5e-11
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 1e-05
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 5e-11
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 6e-07
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 5e-11
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 1e-04
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 6e-11
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 6e-11
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 2e-05
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 1e-10
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-10
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 7e-06
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 1e-10
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 5e-07
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-10
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-10
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 2e-10
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 1e-04
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-10
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 5e-10
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 9e-10
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 5e-07
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 1e-09
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 1e-09
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 2e-06
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-09
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 2e-09
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 2e-09
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 3e-09
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-09
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 3e-09
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 5e-09
2eue_A275 Carbon catabolite derepressing protein kinase; kin 6e-09
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 7e-09
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 8e-09
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 9e-09
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 1e-08
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-08
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 1e-08
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 3e-08
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 3e-08
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 4e-08
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 7e-08
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 7e-08
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-07
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 2e-07
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 2e-07
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 3e-07
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 3e-07
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 4e-07
3q4u_A301 Activin receptor type-1; structural genomics conso 5e-07
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 6e-07
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 6e-07
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 7e-07
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 1e-06
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 4e-06
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 5e-06
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 5e-06
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 5e-06
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 6e-06
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-05
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 1e-05
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-05
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-05
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-05
3soc_A322 Activin receptor type-2A; structural genomics cons 2e-05
3lzb_A327 Epidermal growth factor receptor; epidermal growth 2e-05
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 3e-05
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 4e-05
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 4e-05
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 4e-05
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 4e-05
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 5e-05
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 6e-05
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 7e-05
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 9e-05
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 9e-05
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 9e-05
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 1e-04
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 1e-04
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 1e-04
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 1e-04
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 2e-04
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 2e-04
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-04
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-04
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 2e-04
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 2e-04
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 2e-04
3poz_A327 Epidermal growth factor receptor; kinase domain, a 2e-04
2xir_A316 Vascular endothelial growth factor receptor 2; ang 3e-04
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 3e-04
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 3e-04
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 4e-04
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 5e-04
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 5e-04
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 7e-04
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 8e-04
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
 Score =  249 bits (638), Expect = 3e-77
 Identities = 114/193 (59%), Positives = 144/193 (74%), Gaps = 1/193 (0%)

Query: 52  PESDQEKMEDSNDNEES-KDYRVGGYHPVNIGDLYEQRYFVIRKLGWGHFSTVWLCWDKI 110
           PE ++E +   +D +E   DY  GGYH V IGDL+  RY VIRKLGWGHFSTVWL WD  
Sbjct: 1   PEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQ 60

Query: 111 ATRFVALKIMKSAPQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISGVHGVHI 170
             +FVA+K++KSA  YTETA+DEI+LLK V+ +DP DPNRE +VQLLD+F ISGV+G HI
Sbjct: 61  GKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHI 120

Query: 171 CMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLL 230
           CMV EV G +  K ++KSN +G+PL  VK I++Q+L+ L+YLH KC IIHTDIKPEN+LL
Sbjct: 121 CMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILL 180

Query: 231 GSNNDHIFELALK 243
             N  +I  LA +
Sbjct: 181 SVNEQYIRRLAAE 193


>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query612
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 100.0
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 100.0
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 100.0
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
3uqc_A286 Probable conserved transmembrane protein; structur 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.98
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.98
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.98
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.97
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.97
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.97
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.97
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.96
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.95
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.94
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.94
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.94
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.93
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.93
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.93
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.93
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.93
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.92
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.91
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.91
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.91
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.9
4aoj_A329 High affinity nerve growth factor receptor; transf 99.9
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.9
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.9
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.9
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.88
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.88
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.87
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.87
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.86
3niz_A311 Rhodanese family protein; structural genomics, str 99.86
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.86
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.86
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.86
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.86
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.85
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.85
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.85
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.85
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.85
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.85
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.85
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.85
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.85
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.85
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.85
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.85
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.84
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.84
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.84
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.84
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.84
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.84
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.84
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.84
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.84
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.84
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.84
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.83
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.83
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.83
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.83
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.83
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.83
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.83
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.83
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.83
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.83
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.82
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.82
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.82
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.82
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.82
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.81
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.81
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.81
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.81
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.81
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.81
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.81
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.81
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.81
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.81
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.8
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.8
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.8
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.8
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.8
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.8
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.8
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.8
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.8
3ork_A311 Serine/threonine protein kinase; structural genomi 99.8
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.8
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.8
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.8
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.8
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.8
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.8
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.8
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.8
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.8
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.79
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.79
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.79
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.79
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.79
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.79
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.79
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.79
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.79
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.79
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.79
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.78
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.78
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.78
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.78
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.78
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.78
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.78
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.78
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.78
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.78
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.78
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.78
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.78
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.78
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.78
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.78
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.78
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.78
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.78
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.78
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.77
3soc_A322 Activin receptor type-2A; structural genomics cons 99.77
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.77
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.77
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.77
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.77
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.77
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.77
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.77
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.77
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.77
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.77
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.77
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.77
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.76
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.76
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.76
3bhy_A283 Death-associated protein kinase 3; death associate 99.76
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.76
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.76
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.76
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.76
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.76
3q4u_A301 Activin receptor type-1; structural genomics conso 99.76
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.76
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.76
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.76
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.76
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.75
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.75
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.75
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.75
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.75
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.75
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.75
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.75
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.75
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.75
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.75
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.75
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.75
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.75
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.75
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.74
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.74
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.74
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.74
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.74
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.74
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.74
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.74
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.74
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.74
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.74
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.74
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.74
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.74
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.74
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.74
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.73
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.73
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.73
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.73
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.73
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.73
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.73
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.73
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.73
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.73
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.73
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.73
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.73
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.73
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.73
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.73
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.73
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.73
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.73
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.72
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.72
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.72
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.72
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.72
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.72
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.72
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.72
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.72
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.72
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.71
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.71
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.71
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.71
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.71
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.71
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.71
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.71
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.71
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.71
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.71
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.71
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.7
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.7
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.7
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.7
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.69
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.69
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.69
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.69
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.69
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.69
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.68
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.68
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.67
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.67
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.67
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.66
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.62
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.57
3uqc_A286 Probable conserved transmembrane protein; structur 99.45
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.24
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.18
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.12
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 98.95
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=100.00  E-value=9.3e-48  Score=399.07  Aligned_cols=208  Identities=19%  Similarity=0.208  Sum_probs=182.1

Q ss_pred             cceeEEEEecccCceEEEEEEEccCCeEEEEEEecCC----chhhHHHHHHHHHHHHhhccCCCCCccccceeeccceee
Q psy13755         87 QRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSA----PQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTI  162 (612)
Q Consensus        87 ~~y~i~~~LG~G~fG~Vy~a~~~~~~~~vAiK~i~~~----~~~~~~~~~Ei~il~~L~h~~~~~p~h~~Iv~l~~~~~~  162 (612)
                      ++|++++.||+|+||+||+|+++.+++.||||++.+.    ....+.+.+|+++|+.|+|        ||||+++++|+.
T Consensus        32 ~dy~i~~~lG~G~fg~V~~a~~~~~~~~~AiK~i~k~~~~~~~~~~~~~~E~~il~~l~H--------pnIv~l~~~~~~  103 (311)
T 4aw0_A           32 EDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDH--------PFFVKLYFTFQD  103 (311)
T ss_dssp             GGEEEEEEEEEETTEEEEEEEETTTCCEEEEEEEEHHHHHHTTCHHHHHHHHHHHTTCCC--------TTBCCEEEEEEC
T ss_pred             cccEEEEEEecccCeEEEEEEECCCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHHHhCCC--------CCCCeEEEEEEe
Confidence            5699999999999999999999999999999999643    2345678999999999954        569999999987


Q ss_pred             cCccceEEEEEEeecCCCcHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHHhCCCcEecCCCCCCEEEecCCCceEEEEe
Q psy13755        163 SGVHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELAL  242 (612)
Q Consensus       163 ~~~~~~~~~lVmE~~~~~~l~~l~~~~~~~l~~~~~~~i~~Qil~aL~yLH~~~gIIHRDLKPeNILl~~~~~~i~kl~D  242 (612)
                      ..    ++|||||||.|++|..++...+ .+++..++.|+.||+.||+|||++ |||||||||+||||+.++.  +||+|
T Consensus       104 ~~----~~yivmEy~~gG~L~~~i~~~~-~l~e~~~~~~~~qi~~al~ylH~~-~IiHRDlKPeNILl~~~g~--vKl~D  175 (311)
T 4aw0_A          104 DE----KLYFGLSYAKNGELLKYIRKIG-SFDETCTRFYTAEIVSALEYLHGK-GIIHRDLKPENILLNEDMH--IQITD  175 (311)
T ss_dssp             SS----EEEEEECCCTTEEHHHHHHHHS-SCCHHHHHHHHHHHHHHHHHHHHT-TEECSCCSGGGEEECTTSC--EEECC
T ss_pred             CC----EEEEEEecCCCCCHHHHHHHcC-CCCHHHHHHHHHHHHHHHHHHHHC-CCccCCCCHHHeEEcCCCC--EEEEE
Confidence            66    8999999999999988887654 499999999999999999999999 9999999999999998876  89999


Q ss_pred             cccccccccCC---CCcccCCCccccccccccccccccccccCCcccceehHHHHHHHhhcCCCCCCChHHhhhHHhh
Q psy13755        243 KTYNQVLKENL---PLLHMRNIPSFIQKQLNSNSKDRKMVKYQKYVEKSLSIIVQSYSNLNRKDGEGTAKETNQIKDE  317 (612)
Q Consensus       243 fg~~~~~~~~~---~~~~~~GTp~Y~aPE~~~~~~~~~~~~~~~~~~DiwSlGvilyelltG~~p~~~~~~~~~i~~~  317 (612)
                      ||+++......   ...+.+|||.|||||++.+..       |+.++|||||||+||+|++|+.||...+..+-+...
T Consensus       176 FGla~~~~~~~~~~~~~~~~GTp~YmAPEvl~~~~-------y~~~~DiWSlGvilyeml~G~~PF~~~~~~~~~~~i  246 (311)
T 4aw0_A          176 FGTAKVLSPESKQARANSFVGTAQYVSPELLTEKS-------ACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKI  246 (311)
T ss_dssp             CTTCEECCTTTTCCCBCCCCSCGGGCCHHHHHHSC-------BCHHHHHHHHHHHHHHHHHSSCSSCCSSHHHHHHHH
T ss_pred             cCCceecCCCCCcccccCcccCcccCCHHHHcCCC-------CCcHHHHHHHHHHHHHHHhCCCCCCCCCHHHHHHHH
Confidence            99999875432   334789999999999998876       999999999999999999999999876655544443



>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 612
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 3e-35
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 2e-12
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-25
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 6e-05
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 5e-24
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 8e-10
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 6e-24
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-07
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 9e-23
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 4e-06
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 9e-23
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-05
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 1e-22
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 1e-07
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-22
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-07
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 4e-22
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-07
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 7e-22
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-04
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 7e-22
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 3e-04
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 8e-22
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-06
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-21
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 4e-21
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 5e-08
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-21
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-05
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 5e-21
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 9e-21
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 5e-08
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-20
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 8e-05
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-20
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 9e-04
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 5e-20
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 9e-05
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-19
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 9e-07
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 4e-19
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 8e-06
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 8e-19
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-18
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-07
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-18
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-06
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-18
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-18
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 7e-07
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 3e-18
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-06
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 5e-18
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 0.001
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 5e-18
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 7e-06
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 8e-18
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-06
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-17
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 4e-04
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-17
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 6e-04
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-17
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 6e-06
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 2e-17
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-17
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-04
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-17
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-05
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 5e-17
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 5e-06
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 5e-17
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 6e-05
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 5e-17
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 6e-17
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 1e-04
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 7e-17
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 8e-07
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-16
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-04
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-16
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 3e-05
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 6e-16
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-15
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-15
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-15
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-15
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-06
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-15
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 8e-15
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 9e-15
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-14
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 5e-05
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 3e-14
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 3e-14
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 0.001
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-13
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 0.002
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-12
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 9e-12
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-11
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-11
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 0.004
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-11
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-11
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 5e-09
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 8e-04
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Sky1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  134 bits (337), Expect = 3e-35
 Identities = 82/172 (47%), Positives = 107/172 (62%), Gaps = 4/172 (2%)

Query: 76  YHPVNIGDLYE-QRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSAPQYTETAIDEI 134
           YHP   G+ Y+  RY ++RKLGWGHFSTVWL  D +    VA+KI++    YTE A DEI
Sbjct: 1   YHPAFKGEPYKDARYILVRKLGWGHFSTVWLAKDMVNNTHVAMKIVRGDKVYTEAAEDEI 60

Query: 135 KLLKCVQETD---PQDPNREKIVQLLDNFTISGVHGVHICMVLEVEGFNTYKLLLKSNNK 191
           KLL+ V + D           I++LLD+F   G +GVH+ MV EV G N   L+ K  ++
Sbjct: 61  KLLQRVNDADNTKEDSMGANHILKLLDHFNHKGPNGVHVVMVFEVLGENLLALIKKYEHR 120

Query: 192 GIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELALK 243
           GIPL  VK I KQLL  L+Y+H +C IIHTDIKPENVL+   +     + +K
Sbjct: 121 GIPLIYVKQISKQLLLGLDYMHRRCGIIHTDIKPENVLMEIVDSPENLIQIK 172


>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query612
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.93
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.92
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.92
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.92
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.92
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.92
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.92
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.92
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.92
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.91
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.9
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.9
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.9
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.9
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.9
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.9
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.89
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.89
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.89
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.89
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.89
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.89
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.89
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.89
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.89
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.88
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.88
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.88
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.87
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.87
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.87
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.87
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.87
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.87
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.87
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.87
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.87
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.86
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.86
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.86
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.86
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.86
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.85
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.85
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.85
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.84
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.84
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.84
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.84
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.83
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.83
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.83
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.82
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.82
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.81
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.79
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.79
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.78
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.82
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 98.74
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.58
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 97.95
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.4
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 96.86
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 96.04
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 94.71
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 94.02
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.6e-45  Score=376.83  Aligned_cols=210  Identities=19%  Similarity=0.269  Sum_probs=183.9

Q ss_pred             ccceeEEEEecccCceEEEEEEEccCCeEEEEEEecCC-chhhHHHHHHHHHHHHhhccCCCCCccccceeeccceeecC
Q psy13755         86 EQRYFVIRKLGWGHFSTVWLCWDKIATRFVALKIMKSA-PQYTETAIDEIKLLKCVQETDPQDPNREKIVQLLDNFTISG  164 (612)
Q Consensus        86 ~~~y~i~~~LG~G~fG~Vy~a~~~~~~~~vAiK~i~~~-~~~~~~~~~Ei~il~~L~h~~~~~p~h~~Iv~l~~~~~~~~  164 (612)
                      .++|++++.||+|+||+||+|+++.+|+.||||++... ....+.+.+|+.+|+.++|        ||||+++++|....
T Consensus        19 ~~~Y~~~~~iG~G~fg~Vy~a~~~~~~~~vAvK~~~~~~~~~~~~~~~E~~il~~l~H--------pnIv~~~~~~~~~~   90 (293)
T d1yhwa1          19 KKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENKN--------PNIVNYLDSYLVGD   90 (293)
T ss_dssp             TTTBCSCEECCCSSSCEEEEEEBTTTCCEEEEEEEEGGGCSCHHHHHHHHHHHHHCCC--------TTBCCEEEEEEETT
T ss_pred             ccccEEEEEEecCcCcEEEEEEECCCCCEEEEEEEecccChHHHHHHHHHHHHHhCCC--------CCEeeEeEEEEECC
Confidence            45799999999999999999999999999999998643 2345678999999999955        56999999998776


Q ss_pred             ccceEEEEEEeecCCCcHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHHhCCCcEecCCCCCCEEEecCCCceEEEEecc
Q psy13755        165 VHGVHICMVLEVEGFNTYKLLLKSNNKGIPLYNVKCIVKQLLEALEYLHNKCNIIHTDIKPENVLLGSNNDHIFELALKT  244 (612)
Q Consensus       165 ~~~~~~~lVmE~~~~~~l~~l~~~~~~~l~~~~~~~i~~Qil~aL~yLH~~~gIIHRDLKPeNILl~~~~~~i~kl~Dfg  244 (612)
                          ++|+|||||.+++|..++...  .+++..++.+++||+.||+|||++ |||||||||+|||++.++.  +||+|||
T Consensus        91 ----~~~ivmEy~~gg~L~~~~~~~--~l~~~~~~~i~~qi~~aL~yLH~~-~iiHrDiKp~NILl~~~~~--vkl~DFG  161 (293)
T d1yhwa1          91 ----ELWVVMEYLAGGSLTDVVTET--CMDEGQIAAVCRECLQALEFLHSN-QVIHRDIKSDNILLGMDGS--VKLTDFG  161 (293)
T ss_dssp             ----EEEEEEECCTTCBHHHHHHHS--CCCHHHHHHHHHHHHHHHHHHHHT-TEECCCCSGGGEEECTTCC--EEECCCT
T ss_pred             ----EEEEEEEecCCCcHHHHhhcc--CCCHHHHHHHHHHHHHHHHHHHHC-CCcccCCcHHHeEECCCCc--Eeeccch
Confidence                899999999999999887764  499999999999999999999999 9999999999999998875  8999999


Q ss_pred             cccccccCCC-CcccCCCccccccccccccccccccccCCcccceehHHHHHHHhhcCCCCCCChHHhhhHHhhhh
Q psy13755        245 YNQVLKENLP-LLHMRNIPSFIQKQLNSNSKDRKMVKYQKYVEKSLSIIVQSYSNLNRKDGEGTAKETNQIKDERN  319 (612)
Q Consensus       245 ~~~~~~~~~~-~~~~~GTp~Y~aPE~~~~~~~~~~~~~~~~~~DiwSlGvilyelltG~~p~~~~~~~~~i~~~~~  319 (612)
                      ++........ ....+|||.|||||++.+..       ++.++|||||||++|+|++|+.||......+.+.....
T Consensus       162 ~a~~~~~~~~~~~~~~gt~~Y~aPE~~~~~~-------~~~~~DiwSlGvilyemltG~~Pf~~~~~~~~~~~~~~  230 (293)
T d1yhwa1         162 FCAQITPEQSKRSTMVGTPYWMAPEVVTRKA-------YGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIAT  230 (293)
T ss_dssp             TCEECCSTTCCBCCCCSCGGGCCHHHHSSSC-------BCTHHHHHHHHHHHHHHHHSSCTTTTSCHHHHHHHHHH
T ss_pred             hheeeccccccccccccCCCccChhhhcCCC-------CCchhceehHhHHHHHHhhCCCCCCCCCHHHHHHHHHh
Confidence            9988765443 34788999999999998876       89999999999999999999999987666665555443



>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure