Diaphorina citri psyllid: psy13765

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600------

MAQVEFELSNSLSSSESGTSLETADRIEIKFKDLTYTVSTGLGFKQEPKDVLKNLCGRFPSNQLIAIMGPSGAGKSSLLDVLSGYRSNGVTGQILTNGHSRNINAFRRVSCYIQQDDRLQPLLTIENVMSLLGLDESQNTRSSQLSGGQKKRLSIALELINNPRVMFLDEPTTSNPNDQKKRLSIALELINNPRVMFLDEPTTGLDSQSCSQCIKLLKMISQQGRTIICTIHQPSATLFQMFDQVYLLSGGQCLYQGATDQLVNYLSSVNLPCPKYHNPADFVIELASGEYGVDNINAMVEQAQNDVKPDKKTKKTKHCTYSNQILQDTSYSNQLGVLLSRGLLKVKRDSTLTHLRIIVNIFVALMLGVLFQNSGEYASSVLINYNLLFSILIHHVMTSMMLNILTFPMEMSILIKEHFNRWYSLKAYYVSVNLLDIPVAGFCCLLFTTIVYPLTGQPMELTRFTMFNCTSLLVVFIAQSVGYMVGAVFNVVNGTFVGPVLVVPMMMFSGFGVSINDIPKYMRWGSELSYLRYGLEGYVAAIYGLDRKTLQCDELYCHYKEPKKFLQTVSQPSDNFWSSSVTLVFILIVMKLIAYFFLSWRIKVMR

ccccHHHHccccccccccccccccccEEEEEEEEEEEECcccccccccccccccccCEEcccEEEEEEccccccHHHHHHHHccccccccEEEEEEcccccccHHHHHcccEEcccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccccEEEEcccccHHHHHHHcccccccccccHHHHHHHHcccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc

*************************RIEIKFKDLTYTVSTGLGFKQEPKDVLKNLCGRFPSNQLIAIMGPSGAGKSSLLDVLSGYRSNGVTGQILTNGHSRNINAFRRVSCYIQQDDRLQPLLTIENVMSLLGLD***************KRLSIALELINNPRVMFL********NDQKKRLSIALELINNPRVMFLDEPTTGLDSQSCSQCIKLLKMISQQGRTIICTIHQPSATLFQMFDQVYLLSGGQCLYQGATDQLVNYLSSVNLPCPKYHNPADFVIELASGEYGVDNINAMVE*****************CTYSNQILQDTSYSNQLGVLLSRGLLKVKRDSTLTHLRIIVNIFVALMLGVLFQNSGEYASSVLINYNLLFSILIHHVMTSMMLNILTFPMEMSILIKEHFNRWYSLKAYYVSVNLLDIPVAGFCCLLFTTIVYPLTGQPMELTRFTMFNCTSLLVVFIAQSVGYMVGAVFNVVNGTFVGPVLVVPMMMFSGFGVSINDIPKYMRWGSELSYLRYGLEGYVAAIYGLDRKTLQCDELYCHYKEPKKFLQTVSQPSDNFWSSSVTLVFILIVMKLIAYFFLSWRIKV**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ATP-binding cassette sub-family G member 4	May be involved in macrophage lipid homeostasis.	confident	Q9H172

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006911 [BP]	phagocytosis, engulfment	probable	GO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0032367 [BP]	intracellular cholesterol transport	probable	GO:0033036, GO:0006810, GO:0015918, GO:0046907, GO:0015850, GO:0032366, GO:0032365, GO:0030301, GO:0006869, GO:0044765, GO:0044763, GO:0044699, GO:0071702, GO:0008150, GO:0009987, GO:0051234, GO:0010876, GO:0051179, GO:0051649, GO:0051641
GO:0015849 [BP]	organic acid transport	probable	GO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0010888 [BP]	negative regulation of lipid storage	probable	GO:0010883, GO:0008150, GO:0065007, GO:0048519, GO:0032879, GO:0050789
GO:0009897 [CC]	external side of plasma membrane	probable	GO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0043190 [CC]	ATP-binding cassette (ABC) transporter complex	probable	GO:0043234, GO:0044425, GO:0016020, GO:0032991, GO:0005575
GO:0017127 [MF]	cholesterol transporter activity	probable	GO:0005319, GO:0005215, GO:0015248, GO:0022892, GO:0003674
GO:0055099 [BP]	response to high density lipoprotein particle stimulus	probable	GO:0009719, GO:0050896, GO:0008150, GO:0042221, GO:0055094, GO:0010033
GO:0010875 [BP]	positive regulation of cholesterol efflux	probable	GO:0032368, GO:0051050, GO:0032374, GO:0032376, GO:0032371, GO:0032370, GO:0032373, GO:0065007, GO:0051049, GO:0048518, GO:0008150, GO:0032879, GO:0050789, GO:0010874
GO:0009737 [BP]	response to abscisic acid stimulus	probable	GO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0009725, GO:0042221, GO:0097305, GO:0010033
GO:0055091 [BP]	phospholipid homeostasis	probable	GO:0042592, GO:0050801, GO:0048878, GO:0055088, GO:0065007, GO:0008150, GO:0055081, GO:0065008
GO:0005548 [MF]	phospholipid transporter activity	probable	GO:0005319, GO:0005215, GO:0022892, GO:0003674
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0055037 [CC]	recycling endosome	probable	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0045542 [BP]	positive regulation of cholesterol biosynthetic process	probable	GO:0065007, GO:0009893, GO:0019216, GO:0009891, GO:0090205, GO:0019218, GO:0046890, GO:0009889, GO:0090181, GO:0045940, GO:0010893, GO:0050810, GO:0008150, GO:0045834, GO:0048518, GO:0046889, GO:0019222, GO:0045540, GO:0050789, GO:0080090
GO:0034437 [MF]	glycoprotein transporter activity	probable	GO:0008565, GO:0005215, GO:0022892, GO:0003674, GO:1901505
GO:0019534 [MF]	toxin transporter activity	probable	GO:0005215, GO:0003674
GO:0009651 [BP]	response to salt stress	probable	GO:0008150, GO:0009628, GO:0006950, GO:0006970, GO:0050896
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0034374 [BP]	low-density lipoprotein particle remodeling	probable	GO:0071825, GO:0071827, GO:0044707, GO:0034367, GO:0034368, GO:0034369, GO:0016043, GO:0008150, GO:0043933, GO:0032501, GO:0097006, GO:0071840, GO:0065007, GO:0050789, GO:0044699
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0043531 [MF]	ADP binding	probable	GO:0043168, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0034041 [MF]	sterol-transporting ATPase activity	probable	GO:0003674, GO:0034040, GO:0016887, GO:0042626, GO:0016820, GO:0042623, GO:1901618, GO:0015399, GO:0022804, GO:0005319, GO:0016787, GO:0005215, GO:0017111, GO:0003824, GO:0022891, GO:0016818, GO:0022892, GO:0043492, GO:0016817, GO:0015665, GO:0016462, GO:0022857, GO:0015248, GO:0015405
GO:0033700 [BP]	phospholipid efflux	probable	GO:0006810, GO:0051234, GO:0006869, GO:0015914, GO:0071702, GO:0015711, GO:0051179, GO:0044765, GO:0006820, GO:0008150, GO:0015748, GO:0033036, GO:0010876, GO:0006811, GO:0044699
GO:0034375 [BP]	high-density lipoprotein particle remodeling	probable	GO:0071825, GO:0071827, GO:0044707, GO:0034367, GO:0034368, GO:0034369, GO:0016043, GO:0008150, GO:0043933, GO:0032501, GO:0097006, GO:0071840, GO:0065007, GO:0050789, GO:0044699
GO:0042987 [BP]	amyloid precursor protein catabolic process	probable	GO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0042982
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032502 [BP]	developmental process	probable	GO:0008150
GO:0034436 [BP]	glycoprotein transport	probable	GO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0044765, GO:0008150, GO:0071702, GO:0015031, GO:0051234, GO:0051179, GO:0044699, GO:1901264
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010872 [BP]	regulation of cholesterol esterification	probable	GO:0080090, GO:0019222, GO:0019216, GO:0019218, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0042632 [BP]	cholesterol homeostasis	probable	GO:0042592, GO:0048878, GO:0055088, GO:0065007, GO:0008150, GO:0065008, GO:0055092
GO:0055085 [BP]	transmembrane transport	probable	GO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0008203 [BP]	cholesterol metabolic process	probable	GO:0044238, GO:0044710, GO:0016125, GO:0008202, GO:0006629, GO:0006066, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:1901360, GO:1901615
GO:0043691 [BP]	reverse cholesterol transport	probable	GO:0051234, GO:0006810, GO:0015918, GO:0006869, GO:0015850, GO:0030301, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0051179, GO:0044699
GO:0033344 [BP]	cholesterol efflux	probable	GO:0051234, GO:0006810, GO:0015918, GO:0006869, GO:0015850, GO:0030301, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 27-264
View the alignment between query and template
View the model in PyMOL

Template: 1SXJ, chain E
Confidence level:confident
Coverage over the Query: 65-93,111-124,145-164,192-289
View the alignment between query and template
View the model in PyMOL