Diaphorina citri psyllid: psy13776


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------54
MALLSARLAAALAKNIPSSLNQANWAATQIASRKFNVSASSRAAEISSILEERILGSAPKAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKMSEAHGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKVDRGSINCGQLIIGDRQTGKTALAIDTIINQKRKKRRRLLKYNLLSAGIKAVDSLVPIGRGQRELIIGDRQTGKTALAIDTIINQKSIYAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQDEKKKLYCIYVAIGQKRSTVAQIVKRLTDSGAMGYTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKMSEAHGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGMALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGIRPAINVGLSVSRVGSAAQTRAMKQTGKIRSWNGWLSLLKQLYYR
ccHHHHHHHHHHHHccccHHHHcccHHHHHHHccccccccccHHHHHHHHHHHHccccccHHHEEcccccccccccEEEccccEEEEccHHHHHHHHcccccccCEEEEEcccccccccCEEEEEcccccccccccEEEEccEEEECccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccHHHHHccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEEEcccHHHHHHHHHHHcccccccEEEEEEEcccccccccccccccccHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHcccccccccccccEEEEEHHHHHHHHHccccccccccccccccccccccCEEEEccccEEEccccEEEccccccccccccccccccccEECccHHHHccccEEEccccCEEEccccccccccccccccccccccccEEEcccHHHHHHHHHHHccccccccHHHHHHHHHcc
**********************ANWAATQIA****************SILEERILGSAPKAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKMSEAHGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKVDRGSINCGQLIIGDRQTGKTALAIDTIINQKRKKRRRLLKYNLLSAGIKAVDSLVPIGRGQRELIIGDRQTGKTALAIDTIINQKSIYAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQDEKKKLYCIYVAIGQKRSTVAQIVKRLTDSGAMGYTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKMS***GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGMALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGIRPAINVGLSVSRVGSAAQTRAMKQTGKIRSWNGWLSLLKQLYY*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLSARLAAALAKNIPSSLNQANWAATQIASRKFNVSASSRAAEISSILEERILGSAPKAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKMSEAHGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKVDRGSINCGQLIIGDRQTGKTALAIDTIINQKRKKRRRLLKYNLLSAGIKAVDSLVPIGRGQRELIIGDRQTGKTALAIDTIINQKSIYAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQDEKKKLYCIYVAIGQKRSTVAQIVKRLTDSGAMGYTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKMSEAHGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGMALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGIRPAINVGLSVSRVGSAAQTRAMKQTGKIRSWNGWLSLLKQLYYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP synthase subunit alpha, mitochondrial Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites.confidentP25705
ATP synthase subunit alpha, mitochondrial Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites.confidentP35381
ATP synthase subunit alpha, mitochondrial Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites.confidentP15999

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009941 [CC]chloroplast envelopeprobableGO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0015992 [BP]proton transportprobableGO:0006818, GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0046034 [BP]ATP metabolic processprobableGO:0009141, GO:0009144, GO:0034641, GO:0006807, GO:0044237, GO:0072521, GO:0009259, GO:1901360, GO:0006139, GO:0044710, GO:0042278, GO:0071704, GO:0009199, GO:0009205, GO:0009987, GO:0006725, GO:0009150, GO:0009117, GO:0009116, GO:0008152, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0008266 [MF]poly(U) RNA bindingprobableGO:0097159, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:0008187, GO:1901363, GO:0005488
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045260 [CC]plasma membrane proton-transporting ATP synthase complexprobableGO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0045259, GO:0005623, GO:0005622, GO:0005575, GO:0071944, GO:0005886, GO:0044424, GO:0044425, GO:0016469, GO:0044459

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.3.-3'-nucleotidase.probable
3.6.3.14Transferred entry: 3.6.3.14.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R9V, chain A
Confidence level:very confident
Coverage over the Query: 55-233,281-443,495-537
View the alignment between query and template
View the model in PyMOL
Template: 2R9V, chain A
Confidence level:very confident
Coverage over the Query: 442-497
View the alignment between query and template
View the model in PyMOL
Template: 3ICE, chain A
Confidence level:probable
Coverage over the Query: 234-276
View the alignment between query and template
View the model in PyMOL