Psyllid ID: psy13776
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 539 | ||||||
| 383860333 | 547 | PREDICTED: ATP synthase subunit alpha, m | 0.755 | 0.744 | 0.541 | 1e-129 | |
| 91087467 | 551 | PREDICTED: similar to AGAP005134-PA isof | 0.756 | 0.740 | 0.534 | 1e-128 | |
| 48100966 | 547 | PREDICTED: ATP synthase subunit alpha, m | 0.755 | 0.744 | 0.539 | 1e-128 | |
| 322785985 | 544 | hypothetical protein SINV_08923 [Solenop | 0.756 | 0.75 | 0.549 | 1e-128 | |
| 195121302 | 550 | GI20326 [Drosophila mojavensis] gi|19391 | 0.755 | 0.74 | 0.536 | 1e-127 | |
| 170032139 | 551 | conserved hypothetical protein [Culex qu | 0.768 | 0.751 | 0.540 | 1e-127 | |
| 195383092 | 550 | GJ22050 [Drosophila virilis] gi|19414505 | 0.753 | 0.738 | 0.535 | 1e-127 | |
| 269784695 | 546 | ATP synthase subunit alpha, mitochondria | 0.755 | 0.745 | 0.532 | 1e-127 | |
| 195488017 | 552 | GE14023 [Drosophila yakuba] gi|194178237 | 0.758 | 0.740 | 0.530 | 1e-127 | |
| 52630965 | 551 | putative mitochondrial ATP synthase alph | 0.756 | 0.740 | 0.530 | 1e-127 |
| >gi|383860333|ref|XP_003705645.1| PREDICTED: ATP synthase subunit alpha, mitochondrial-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 466 bits (1200), Expect = e-129, Method: Compositional matrix adjust.
Identities = 289/534 (54%), Positives = 324/534 (60%), Gaps = 127/534 (23%)
Query: 1 MALLSARLAAALAKNIPSSLNQANWAATQIASRKFNVSASSRAAEISSILEERILGSAPK 60
MALLS RLA+++A+ +P++ Q W ++AS K++VS S R+AEISSILE+RILGSAPK
Sbjct: 1 MALLSLRLASSIARQLPNATIQVKWP-LRVASCKYHVSCSRRSAEISSILEDRILGSAPK 59
Query: 61 AVAYRQMSLLLRRPPGREAYPGD----VFYLHSRLLERSAKMSEAHGGGSLTALPVIETQ 116
GR GD V+ L + + + S G +L P
Sbjct: 60 TNL---------EETGRVLSIGDGIARVYGLKNIQADEMVEFSSGLKGMALNLEP----- 105
Query: 117 AGDVSAYIPTNVISITDGQIFLETELFYKVDRGSINCGQLI--IGDRQTGKTALAIDTII 174
+V + N I +G I T V G G+++ +G+ GK L
Sbjct: 106 -DNVGVVVFGNDRHIREGDIVKRTGAIVDVPVGEELLGRVVDALGNPIDGKGPL------ 158
Query: 175 NQKRKKR---------RRLLKYNLLSAGIKAVDSLVPIGRGQRELIIGDRQTGKTALAID 225
N K++ R R+ + GIKAVDSLVPIGRGQRELIIGDRQTGKTALAID
Sbjct: 159 NSKQRFRIGTKAPGIIPRVSVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTALAID 218
Query: 226 TIINQKSIYAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQDEKKKLYCI 285
TIINQK F D G DEKKKLYCI
Sbjct: 219 TIINQKR--------------------FNDAG-------------------DEKKKLYCI 239
Query: 286 YVAIGQKRSTVAQIVKRLTDSGAMGYTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGK 345
YVAIGQKRSTVAQIVKRLTDSGA+ YTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGK
Sbjct: 240 YVAIGQKRSTVAQIVKRLTDSGAINYTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGK 299
Query: 346 HALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKMSEAHGGGSLT 405
HALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLER+AKM+E+ GGGSLT
Sbjct: 300 HALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNESLGGGSLT 359
Query: 406 ALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGMALNLEPDNVGVVVFGNDRLIK 465
ALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKG
Sbjct: 360 ALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKG---------------------- 397
Query: 466 EGDIVKRTGAIVDVPVGEDLLGRVVDALGIRPAINVGLSVSRVGSAAQTRAMKQ 519
IRPAINVGLSVSRVGSAAQT+AMKQ
Sbjct: 398 -----------------------------IRPAINVGLSVSRVGSAAQTKAMKQ 422
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91087467|ref|XP_966334.1| PREDICTED: similar to AGAP005134-PA isoform 1 [Tribolium castaneum] gi|270010980|gb|EFA07428.1| hypothetical protein TcasGA2_TC008728 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|48100966|ref|XP_392639.1| PREDICTED: ATP synthase subunit alpha, mitochondrial isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|322785985|gb|EFZ12601.1| hypothetical protein SINV_08923 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|195121302|ref|XP_002005159.1| GI20326 [Drosophila mojavensis] gi|193910227|gb|EDW09094.1| GI20326 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|170032139|ref|XP_001843940.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167871889|gb|EDS35272.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|195383092|ref|XP_002050260.1| GJ22050 [Drosophila virilis] gi|194145057|gb|EDW61453.1| GJ22050 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|269784695|ref|NP_001161449.1| ATP synthase subunit alpha, mitochondrial [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|195488017|ref|XP_002092136.1| GE14023 [Drosophila yakuba] gi|194178237|gb|EDW91848.1| GE14023 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|52630965|gb|AAU84946.1| putative mitochondrial ATP synthase alpha subunit precursor [Toxoptera citricida] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 539 | ||||||
| FB|FBgn0011211 | 552 | blw "bellwether" [Drosophila m | 0.361 | 0.353 | 0.852 | 1.5e-104 | |
| UNIPROTKB|P25705 | 553 | ATP5A1 "ATP synthase subunit a | 0.361 | 0.352 | 0.822 | 6e-99 | |
| UNIPROTKB|A5A6H5 | 553 | ATP5A1 "ATP synthase subunit a | 0.361 | 0.352 | 0.822 | 6e-99 | |
| UNIPROTKB|Q5R546 | 553 | ATP5A1 "ATP synthase subunit a | 0.361 | 0.352 | 0.822 | 6e-99 | |
| UNIPROTKB|K7EK63 | 449 | ATP5A1 "ATP synthase subunit a | 0.361 | 0.434 | 0.822 | 6e-99 | |
| UNIPROTKB|K7ENP3 | 531 | ATP5A1 "ATP synthase subunit a | 0.361 | 0.367 | 0.822 | 6e-99 | |
| UNIPROTKB|F1MLB8 | 553 | ATP5A1 "ATP synthase subunit a | 0.361 | 0.352 | 0.822 | 7.6e-99 | |
| UNIPROTKB|P19483 | 553 | ATP5A1 "ATP synthase subunit a | 0.361 | 0.352 | 0.822 | 7.6e-99 | |
| UNIPROTKB|F1RPS8 | 533 | ATP5A1 "ATP synthase subunit a | 0.361 | 0.365 | 0.822 | 7.6e-99 | |
| UNIPROTKB|F1NGA2 | 555 | ATP5A1W "ATP synthase subunit | 0.361 | 0.351 | 0.817 | 1.6e-98 |
| FB|FBgn0011211 blw "bellwether" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 836 (299.3 bits), Expect = 1.5e-104, Sum P(2) = 1.5e-104
Identities = 168/197 (85%), Positives = 179/197 (90%)
Query: 254 RDNGKHALIIYDDLSKQAVAYRQDEKKKLYCIYVAIGQKRSTVAQIVKRLTDSGAMGYTI 313
R GK AL I ++++ QDE KKLYCIYVAIGQKRSTVAQIVKRLTDSGAMGY++
Sbjct: 213 RQTGKTALAIDTIINQKRFNEAQDESKKLYCIYVAIGQKRSTVAQIVKRLTDSGAMGYSV 272
Query: 314 IVSATASDAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPG 373
IVSATASDAAPLQYLAPYSGCAMGE+FRD GKHALIIYDDLSKQAVAYRQMSLLLRRPPG
Sbjct: 273 IVSATASDAAPLQYLAPYSGCAMGEYFRDKGKHALIIYDDLSKQAVAYRQMSLLLRRPPG 332
Query: 374 REAYPGDVFYLHSRLLERSAKMSEAHGGGSLTALPVIETQAGDVSAYIPTNVISITDGQI 433
REAYPGDVFYLHSRLLER+AKMS A GGGSLTALPVIETQAGDVSAYIPTNVISITDGQI
Sbjct: 333 REAYPGDVFYLHSRLLERAAKMSPAMGGGSLTALPVIETQAGDVSAYIPTNVISITDGQI 392
Query: 434 FLETELFYKGM--ALNL 448
FLETELFYKG+ A+N+
Sbjct: 393 FLETELFYKGIRPAINV 409
|
|
| UNIPROTKB|P25705 ATP5A1 "ATP synthase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5A6H5 ATP5A1 "ATP synthase subunit alpha, mitochondrial" [Pan troglodytes (taxid:9598)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R546 ATP5A1 "ATP synthase subunit alpha, mitochondrial" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7EK63 ATP5A1 "ATP synthase subunit alpha" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7ENP3 ATP5A1 "ATP synthase subunit alpha" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MLB8 ATP5A1 "ATP synthase subunit alpha" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P19483 ATP5A1 "ATP synthase subunit alpha, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RPS8 ATP5A1 "ATP synthase subunit alpha" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NGA2 ATP5A1W "ATP synthase subunit alpha" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 539 | |||
| PRK09281 | 502 | PRK09281, PRK09281, F0F1 ATP synthase subunit alph | 0.0 | |
| COG0056 | 504 | COG0056, AtpA, F0F1-type ATP synthase, alpha subun | 1e-161 | |
| cd01132 | 274 | cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c | 1e-156 | |
| TIGR00962 | 501 | TIGR00962, atpA, proton translocating ATP synthase | 1e-148 | |
| CHL00059 | 485 | CHL00059, atpA, ATP synthase CF1 alpha subunit | 1e-139 | |
| PRK13343 | 502 | PRK13343, PRK13343, F0F1 ATP synthase subunit alph | 1e-138 | |
| TIGR03324 | 497 | TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, | 4e-94 | |
| PTZ00185 | 574 | PTZ00185, PTZ00185, ATPase alpha subunit; Provisio | 4e-91 | |
| pfam00006 | 213 | pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa | 9e-86 | |
| PRK07165 | 507 | PRK07165, PRK07165, F0F1 ATP synthase subunit alph | 2e-74 | |
| PRK09281 | 502 | PRK09281, PRK09281, F0F1 ATP synthase subunit alph | 6e-68 | |
| cd01132 | 274 | cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c | 2e-63 | |
| COG0056 | 504 | COG0056, AtpA, F0F1-type ATP synthase, alpha subun | 7e-60 | |
| TIGR00962 | 501 | TIGR00962, atpA, proton translocating ATP synthase | 3e-56 | |
| CHL00059 | 485 | CHL00059, atpA, ATP synthase CF1 alpha subunit | 3e-55 | |
| PRK13343 | 502 | PRK13343, PRK13343, F0F1 ATP synthase subunit alph | 3e-54 | |
| TIGR03324 | 497 | TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, | 5e-42 | |
| PRK09281 | 502 | PRK09281, PRK09281, F0F1 ATP synthase subunit alph | 6e-40 | |
| cd01132 | 274 | cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c | 1e-38 | |
| PTZ00185 | 574 | PTZ00185, PTZ00185, ATPase alpha subunit; Provisio | 4e-37 | |
| pfam00006 | 213 | pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa | 1e-33 | |
| CHL00059 | 485 | CHL00059, atpA, ATP synthase CF1 alpha subunit | 4e-27 | |
| PRK09281 | 502 | PRK09281, PRK09281, F0F1 ATP synthase subunit alph | 1e-25 | |
| PRK07165 | 507 | PRK07165, PRK07165, F0F1 ATP synthase subunit alph | 5e-24 | |
| COG0056 | 504 | COG0056, AtpA, F0F1-type ATP synthase, alpha subun | 2e-22 | |
| TIGR02546 | 422 | TIGR02546, III_secr_ATP, type III secretion appara | 6e-20 | |
| TIGR01026 | 440 | TIGR01026, fliI_yscN, ATPase FliI/YscN family | 3e-19 | |
| cd01120 | 165 | cd01120, RecA-like_NTPases, RecA-like NTPases | 5e-18 | |
| COG1157 | 441 | COG1157, FliI, Flagellar biosynthesis/type III sec | 2e-17 | |
| TIGR00962 | 501 | TIGR00962, atpA, proton translocating ATP synthase | 9e-17 | |
| cd01136 | 326 | cd01136, ATPase_flagellum-secretory_path_III, Flag | 2e-16 | |
| CHL00059 | 485 | CHL00059, atpA, ATP synthase CF1 alpha subunit | 3e-16 | |
| cd01135 | 276 | cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- | 4e-16 | |
| TIGR03498 | 418 | TIGR03498, FliI_clade3, flagellar protein export A | 7e-16 | |
| TIGR03324 | 497 | TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, | 9e-16 | |
| PRK06315 | 442 | PRK06315, PRK06315, type III secretion system ATPa | 3e-15 | |
| TIGR03497 | 413 | TIGR03497, FliI_clade2, flagellar protein export A | 3e-15 | |
| PRK07165 | 507 | PRK07165, PRK07165, F0F1 ATP synthase subunit alph | 4e-15 | |
| PRK13343 | 502 | PRK13343, PRK13343, F0F1 ATP synthase subunit alph | 1e-14 | |
| PRK09099 | 441 | PRK09099, PRK09099, type III secretion system ATPa | 1e-14 | |
| PRK08472 | 434 | PRK08472, fliI, flagellum-specific ATP synthase; V | 2e-14 | |
| PRK07721 | 438 | PRK07721, fliI, flagellum-specific ATP synthase; V | 8e-14 | |
| COG1156 | 463 | COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su | 1e-13 | |
| PRK06820 | 440 | PRK06820, PRK06820, type III secretion system ATPa | 2e-13 | |
| PRK08149 | 428 | PRK08149, PRK08149, ATP synthase SpaL; Validated | 5e-13 | |
| PRK07960 | 455 | PRK07960, fliI, flagellum-specific ATP synthase; V | 5e-13 | |
| TIGR03496 | 411 | TIGR03496, FliI_clade1, flagellar protein export A | 6e-13 | |
| PRK06936 | 439 | PRK06936, PRK06936, type III secretion system ATPa | 8e-13 | |
| TIGR03324 | 497 | TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, | 1e-12 | |
| PRK07196 | 434 | PRK07196, fliI, flagellum-specific ATP synthase; V | 1e-12 | |
| PRK05688 | 451 | PRK05688, fliI, flagellum-specific ATP synthase; V | 2e-12 | |
| TIGR01041 | 458 | TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, | 1e-11 | |
| PRK02118 | 436 | PRK02118, PRK02118, V-type ATP synthase subunit B; | 3e-11 | |
| PRK07594 | 433 | PRK07594, PRK07594, type III secretion system ATPa | 4e-11 | |
| PRK08972 | 444 | PRK08972, fliI, flagellum-specific ATP synthase; V | 1e-10 | |
| PRK06002 | 450 | PRK06002, fliI, flagellum-specific ATP synthase; V | 2e-10 | |
| PRK08927 | 442 | PRK08927, fliI, flagellum-specific ATP synthase; V | 2e-09 | |
| TIGR01040 | 466 | TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B | 3e-09 | |
| PRK06793 | 432 | PRK06793, fliI, flagellum-specific ATP synthase; V | 7e-09 | |
| PRK05922 | 434 | PRK05922, PRK05922, type III secretion system ATPa | 8e-09 | |
| pfam02874 | 69 | pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta | 2e-08 | |
| PRK04196 | 460 | PRK04196, PRK04196, V-type ATP synthase subunit B; | 3e-08 | |
| PRK14698 | 1017 | PRK14698, PRK14698, V-type ATP synthase subunit A; | 4e-08 | |
| COG1155 | 588 | COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase su | 6e-08 | |
| TIGR01026 | 440 | TIGR01026, fliI_yscN, ATPase FliI/YscN family | 3e-07 | |
| cd01135 | 276 | cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- | 5e-07 | |
| PRK04192 | 586 | PRK04192, PRK04192, V-type ATP synthase subunit A; | 5e-07 | |
| TIGR01043 | 578 | TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, | 1e-06 | |
| cd01134 | 369 | cd01134, V_A-ATPase_A, V/A-type ATP synthase catal | 2e-06 | |
| TIGR02546 | 422 | TIGR02546, III_secr_ATP, type III secretion appara | 3e-06 | |
| COG1156 | 463 | COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su | 4e-06 | |
| PRK02118 | 436 | PRK02118, PRK02118, V-type ATP synthase subunit B; | 1e-05 | |
| TIGR03497 | 413 | TIGR03497, FliI_clade2, flagellar protein export A | 3e-05 | |
| TIGR01042 | 591 | TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A | 3e-05 | |
| cd01136 | 326 | cd01136, ATPase_flagellum-secretory_path_III, Flag | 4e-05 | |
| PRK08472 | 434 | PRK08472, fliI, flagellum-specific ATP synthase; V | 4e-05 | |
| TIGR01041 | 458 | TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, | 4e-05 | |
| COG1157 | 441 | COG1157, FliI, Flagellar biosynthesis/type III sec | 1e-04 | |
| PRK06315 | 442 | PRK06315, PRK06315, type III secretion system ATPa | 1e-04 | |
| PRK07960 | 455 | PRK07960, fliI, flagellum-specific ATP synthase; V | 1e-04 | |
| PRK06936 | 439 | PRK06936, PRK06936, type III secretion system ATPa | 1e-04 | |
| TIGR03497 | 413 | TIGR03497, FliI_clade2, flagellar protein export A | 2e-04 | |
| cd01120 | 165 | cd01120, RecA-like_NTPases, RecA-like NTPases | 3e-04 | |
| PTZ00185 | 574 | PTZ00185, PTZ00185, ATPase alpha subunit; Provisio | 4e-04 | |
| TIGR01026 | 440 | TIGR01026, fliI_yscN, ATPase FliI/YscN family | 4e-04 | |
| COG1157 | 441 | COG1157, FliI, Flagellar biosynthesis/type III sec | 4e-04 | |
| TIGR03498 | 418 | TIGR03498, FliI_clade3, flagellar protein export A | 6e-04 | |
| TIGR01040 | 466 | TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B | 6e-04 | |
| cd01120 | 165 | cd01120, RecA-like_NTPases, RecA-like NTPases | 8e-04 | |
| PRK07721 | 438 | PRK07721, fliI, flagellum-specific ATP synthase; V | 8e-04 | |
| PRK07196 | 434 | PRK07196, fliI, flagellum-specific ATP synthase; V | 8e-04 | |
| cd01132 | 274 | cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c | 0.001 | |
| COG1157 | 441 | COG1157, FliI, Flagellar biosynthesis/type III sec | 0.001 | |
| cd01136 | 326 | cd01136, ATPase_flagellum-secretory_path_III, Flag | 0.001 | |
| PRK06315 | 442 | PRK06315, PRK06315, type III secretion system ATPa | 0.001 | |
| PRK05688 | 451 | PRK05688, fliI, flagellum-specific ATP synthase; V | 0.001 | |
| TIGR01026 | 440 | TIGR01026, fliI_yscN, ATPase FliI/YscN family | 0.002 | |
| PRK08149 | 428 | PRK08149, PRK08149, ATP synthase SpaL; Validated | 0.002 | |
| TIGR03496 | 411 | TIGR03496, FliI_clade1, flagellar protein export A | 0.002 | |
| PRK08972 | 444 | PRK08972, fliI, flagellum-specific ATP synthase; V | 0.002 | |
| PRK09099 | 441 | PRK09099, PRK09099, type III secretion system ATPa | 0.003 | |
| PRK12597 | 461 | PRK12597, PRK12597, F0F1 ATP synthase subunit beta | 0.004 | |
| TIGR03305 | 449 | TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, | 0.004 |
| >gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
Score = 520 bits (1343), Expect = 0.0
Identities = 191/336 (56%), Positives = 217/336 (64%), Gaps = 99/336 (29%)
Query: 190 LSAGIKAVDSLVPIGRGQRELIIGDRQTGKTALAIDTIINQKSIYAAPLQYLAPYSGCAM 249
L GIKA+D+++PIGRGQRELIIGDRQTGKTA+AIDTIINQK
Sbjct: 146 LQTGIKAIDAMIPIGRGQRELIIGDRQTGKTAIAIDTIINQK------------------ 187
Query: 250 GEFFRDNGKHALIIYDDLSKQAVAYRQDEKKKLYCIYVAIGQKRSTVAQIVKRLTDSGAM 309
K + CIYVAIGQK STVAQ+V++L + GAM
Sbjct: 188 -----------------------------GKDVICIYVAIGQKASTVAQVVRKLEEHGAM 218
Query: 310 GYTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQMSLLLR 369
YTI+V+ATASD APLQYLAPY+GCAMGE+F DNGK ALI+YDDLSKQAVAYRQ+SLLLR
Sbjct: 219 EYTIVVAATASDPAPLQYLAPYAGCAMGEYFMDNGKDALIVYDDLSKQAVAYRQLSLLLR 278
Query: 370 RPPGREAYPGDVFYLHSRLLERSAKMSEAHGGGSLTALPVIETQAGDVSAYIPTNVISIT 429
RPPGREAYPGDVFYLHSRLLER+AK+S+ GGGSLTALP+IETQAGDVSAYIPTNVISIT
Sbjct: 279 RPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSLTALPIIETQAGDVSAYIPTNVISIT 338
Query: 430 DGQIFLETELFYKGMALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRV 489
DGQIFLE++LF
Sbjct: 339 DGQIFLESDLFNA----------------------------------------------- 351
Query: 490 VDALGIRPAINVGLSVSRVGSAAQTRAMKQ-TGKIR 524
GIRPAINVG+SVSRVG AAQ +AMK+ G +R
Sbjct: 352 ----GIRPAINVGISVSRVGGAAQIKAMKKVAGTLR 383
|
Length = 502 |
| >gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235951 PRK07165, PRK07165, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235951 PRK07165, PRK07165, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases | Back alignment and domain information |
|---|
| >gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|235951 PRK07165, PRK07165, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236166 PRK08149, PRK08149, ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235666 PRK06002, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217261 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain | Back alignment and domain information |
|---|
| >gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224077 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >gnl|CDD|235248 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238554 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|233245 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases | Back alignment and domain information |
|---|
| >gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases | Back alignment and domain information |
|---|
| >gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >gnl|CDD|236166 PRK08149, PRK08149, ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 539 | |||
| COG0056 | 504 | AtpA F0F1-type ATP synthase, alpha subunit [Energy | 100.0 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 100.0 | |
| PRK13343 | 502 | F0F1 ATP synthase subunit alpha; Provisional | 100.0 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 100.0 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 100.0 | |
| TIGR00962 | 501 | atpA proton translocating ATP synthase, F1 alpha s | 100.0 | |
| PRK09281 | 502 | F0F1 ATP synthase subunit alpha; Validated | 100.0 | |
| PRK07165 | 507 | F0F1 ATP synthase subunit alpha; Validated | 100.0 | |
| COG1157 | 441 | FliI Flagellar biosynthesis/type III secretory pat | 100.0 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 100.0 | |
| PRK04196 | 460 | V-type ATP synthase subunit B; Provisional | 100.0 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 100.0 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 100.0 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 100.0 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 100.0 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 100.0 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 100.0 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 100.0 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 100.0 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 100.0 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 100.0 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 100.0 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 100.0 | |
| PRK02118 | 436 | V-type ATP synthase subunit B; Provisional | 100.0 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 100.0 | |
| TIGR01043 | 578 | ATP_syn_A_arch ATP synthase archaeal, A subunit. A | 100.0 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 100.0 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 100.0 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 100.0 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 100.0 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| TIGR01042 | 591 | V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th | 100.0 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK04192 | 586 | V-type ATP synthase subunit A; Provisional | 100.0 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 100.0 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 100.0 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 100.0 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK06315 | 442 | type III secretion system ATPase; Provisional | 100.0 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 100.0 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 100.0 | |
| PRK14698 | 1017 | V-type ATP synthase subunit A; Provisional | 100.0 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 100.0 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 100.0 | |
| COG0055 | 468 | AtpD F0F1-type ATP synthase, beta subunit [Energy | 100.0 | |
| COG1156 | 463 | NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E | 100.0 | |
| KOG1353|consensus | 340 | 100.0 | ||
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 100.0 | |
| KOG1351|consensus | 489 | 100.0 | ||
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 100.0 | |
| KOG1350|consensus | 521 | 100.0 | ||
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 100.0 | |
| COG1155 | 588 | NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E | 100.0 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 100.0 | |
| KOG1352|consensus | 618 | 100.0 | ||
| COG1158 | 422 | Rho Transcription termination factor [Transcriptio | 100.0 | |
| COG0056 | 504 | AtpA F0F1-type ATP synthase, alpha subunit [Energy | 99.3 | |
| KOG1353|consensus | 340 | 99.14 | ||
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 99.08 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 98.68 | |
| PRK07165 | 507 | F0F1 ATP synthase subunit alpha; Validated | 98.4 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 98.24 | |
| PRK13343 | 502 | F0F1 ATP synthase subunit alpha; Provisional | 98.2 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 98.16 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 97.96 | |
| TIGR00962 | 501 | atpA proton translocating ATP synthase, F1 alpha s | 97.96 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 97.88 | |
| PRK09281 | 502 | F0F1 ATP synthase subunit alpha; Validated | 97.82 | |
| PF02874 | 69 | ATP-synt_ab_N: ATP synthase alpha/beta family, bet | 97.75 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 97.7 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 97.64 | |
| PRK04196 | 460 | V-type ATP synthase subunit B; Provisional | 97.63 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.53 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 97.53 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 97.53 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 97.52 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 97.49 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 97.48 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 97.48 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 97.41 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 97.38 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 97.36 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 97.36 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 97.34 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 97.34 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.31 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 97.25 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 97.22 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 97.21 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.2 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 97.2 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 97.16 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 97.15 | |
| PRK02118 | 436 | V-type ATP synthase subunit B; Provisional | 97.14 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 97.13 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 97.12 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 97.11 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 97.1 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 97.1 | |
| PRK06315 | 442 | type III secretion system ATPase; Provisional | 97.09 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 97.08 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.07 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 97.07 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 97.0 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 96.97 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 96.96 | |
| TIGR01043 | 578 | ATP_syn_A_arch ATP synthase archaeal, A subunit. A | 96.95 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.94 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 96.94 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 96.92 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 96.91 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 96.84 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 96.83 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 96.82 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 96.8 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 96.79 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 96.7 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 96.68 | |
| TIGR01042 | 591 | V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th | 96.67 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 96.67 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 96.65 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 96.64 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.61 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 96.48 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 96.41 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 96.36 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 96.35 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 96.21 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 96.2 | |
| PRK04192 | 586 | V-type ATP synthase subunit A; Provisional | 96.17 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 96.15 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 96.1 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 96.09 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.91 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 95.87 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 95.76 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 95.68 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 95.62 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 95.32 | |
| PF13173 | 128 | AAA_14: AAA domain | 95.24 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 95.19 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 95.08 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 95.05 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 95.01 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.99 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 94.95 | |
| COG1157 | 441 | FliI Flagellar biosynthesis/type III secretory pat | 94.89 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 94.74 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 94.51 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 94.43 | |
| PF07088 | 484 | GvpD: GvpD gas vesicle protein; InterPro: IPR00978 | 94.35 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 94.29 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 94.27 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 94.25 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 94.21 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 94.06 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 93.93 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 93.93 | |
| KOG0730|consensus | 693 | 93.47 | ||
| PRK14698 | 1017 | V-type ATP synthase subunit A; Provisional | 93.41 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 93.4 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 93.03 | |
| PRK08181 | 269 | transposase; Validated | 93.03 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 92.94 | |
| COG0055 | 468 | AtpD F0F1-type ATP synthase, beta subunit [Energy | 92.94 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 92.86 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 92.81 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 92.8 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 92.78 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 92.75 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 92.75 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 92.73 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 92.67 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 92.62 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 92.61 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 92.58 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 92.55 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 92.51 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 92.48 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 92.46 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 92.45 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 92.39 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 92.38 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 92.34 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 92.34 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 92.32 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 92.3 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 92.3 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 92.28 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 92.26 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 92.25 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 92.18 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.17 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 92.13 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 92.09 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 92.05 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 92.04 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 92.03 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 92.01 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 92.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 91.99 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 91.97 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 91.97 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 91.95 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 91.95 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 91.93 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 91.91 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 91.9 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 91.9 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 91.88 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 91.87 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 91.87 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 91.87 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 91.82 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 91.81 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 91.77 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 91.76 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 91.76 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 91.73 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 91.72 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 91.7 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 91.69 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 91.67 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 91.65 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 91.63 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 91.62 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 91.61 | |
| PRK08727 | 233 | hypothetical protein; Validated | 91.59 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 91.55 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 91.55 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 91.53 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 91.52 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 91.5 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 91.49 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 91.49 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 91.48 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 91.48 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 91.47 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 91.47 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 91.44 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 91.44 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 91.43 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 91.4 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 91.4 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 91.39 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 91.38 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 91.38 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 91.35 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 91.35 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 91.35 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 91.34 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 91.34 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 91.31 | |
| PRK12377 | 248 | putative replication protein; Provisional | 91.31 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 91.26 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 91.25 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 91.25 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 91.25 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 91.23 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 91.21 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 91.18 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 91.18 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 91.17 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 91.16 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 91.16 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 91.1 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 91.08 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 91.06 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 91.03 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 91.01 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 91.01 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 90.98 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 90.97 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 90.96 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 90.94 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 90.94 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 90.93 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 90.92 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 90.91 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 90.91 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 90.9 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 90.89 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 90.88 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 90.86 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 90.86 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 90.86 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 90.84 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 90.83 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 90.8 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 90.79 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 90.78 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 90.74 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 90.74 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 90.72 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 90.71 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 90.7 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 90.7 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 90.68 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 90.66 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 90.66 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 90.64 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 90.64 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 90.62 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 90.61 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 90.61 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 90.61 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 90.6 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 90.56 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 90.56 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 90.56 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 90.55 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 90.51 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 90.5 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 90.5 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 90.47 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 90.45 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 90.44 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 90.44 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 90.43 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 90.43 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 90.42 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 90.41 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 90.4 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 90.4 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 90.39 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 90.38 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 90.38 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 90.34 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 90.29 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 90.28 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 90.28 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 90.28 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 90.26 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 90.25 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 90.24 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 90.24 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 90.23 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 90.2 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 90.2 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 90.19 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 90.13 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 90.08 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 90.0 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 90.0 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 89.98 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 89.94 | |
| PRK06526 | 254 | transposase; Provisional | 89.93 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 89.93 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 89.93 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 89.91 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 89.91 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 89.88 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 89.87 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 89.86 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 89.85 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 89.84 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 89.84 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 89.83 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 89.83 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 89.81 | |
| KOG0744|consensus | 423 | 89.8 | ||
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 89.79 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 89.78 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 89.72 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 89.69 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 89.69 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 89.64 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 89.64 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 89.62 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 89.6 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 89.6 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 89.59 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 89.59 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 89.55 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 89.54 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 89.5 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 89.49 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 89.49 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 89.49 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 89.49 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 89.45 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 89.41 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 89.37 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 89.37 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 89.36 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 89.33 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 89.33 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 89.32 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 89.28 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 89.25 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 89.2 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 89.19 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 89.18 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 89.18 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 89.18 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 89.16 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 89.02 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 89.0 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 88.99 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 88.97 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 88.87 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 88.83 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 88.81 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 88.8 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 88.8 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 88.77 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 88.7 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 88.67 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 88.52 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 88.51 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 88.51 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 88.5 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 88.47 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 88.46 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 88.44 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 88.36 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 88.35 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 88.3 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 88.24 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 88.2 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 88.15 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 88.15 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 88.14 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 88.02 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 87.97 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 87.88 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 87.82 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 87.69 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 87.65 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 87.64 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 87.63 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 87.63 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 87.6 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 87.57 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 87.55 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 87.54 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 87.49 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 87.43 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 87.38 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 87.35 | |
| COG1156 | 463 | NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E | 87.35 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 87.32 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 87.29 | |
| KOG0733|consensus | 802 | 87.21 | ||
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 87.13 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 87.08 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 86.98 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 86.96 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 86.84 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 86.81 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 86.79 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 86.79 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 86.77 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 86.74 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 86.73 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 86.64 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 86.64 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 86.53 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 86.52 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 86.49 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 86.45 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 86.43 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 86.42 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 86.36 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 86.32 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 86.31 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 86.3 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 86.3 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 86.24 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 86.12 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 86.1 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 86.03 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 86.02 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 85.99 | |
| COG1155 | 588 | NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E | 85.9 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 85.85 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 85.83 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 85.71 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 85.6 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 85.52 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 85.51 | |
| PRK06217 | 183 | hypothetical protein; Validated | 85.51 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 85.45 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 85.44 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 85.44 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 85.35 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 85.29 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 85.22 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 85.2 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 85.18 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 85.11 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 85.09 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 85.08 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 85.06 |
| >COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.4e-118 Score=931.36 Aligned_cols=380 Identities=58% Similarity=0.851 Sum_probs=360.3
Q ss_pred cCCChHHHHHHHHHHHhcCcchhhhhhhhcccccccCceeeecCCe----eEEccchhhhhcccccccCCeEEEEEeccc
Q psy13776 39 ASSRAAEISSILEERILGSAPKAVAYRQMSLLLRRPPGREAYPGDV----FYLHSRLLERSAKMSEAHGGGSLTALPVIE 114 (539)
Q Consensus 39 ~~~~~~ei~~~l~~~i~~~~~~~~~~~ei~g~~~e~~G~v~~IGDg----~gL~~~~~~~~gEVV~f~~g~~G~vl~l~~ 114 (539)
|.++++|++++++++|++|+...+. ++.|.+.+|||+ +||.+. +.+|+++|+++.+|++||||+
T Consensus 1 ~~~~~~ei~~~i~~~i~~~~~~~~~---------~~~g~V~sv~DgIa~v~Gl~~~---~~~E~~ef~~~v~G~alnle~ 68 (504)
T COG0056 1 MQLNPTEISSLIKQQIENFDVEAEV---------KEVGTVISVGDGIARVSGLENV---MAGELVEFPGGVKGMALNLEE 68 (504)
T ss_pred CCCcHHHHHHHHHHHHHhcchhhhh---------hccceEEEEecceEEEecCchh---hcCceEEecCCcEEEEEeccc
Confidence 3567899999999999999998888 899999999999 888888 999999999999999999999
Q ss_pred cCCCcEEEEcccCCcCCCCCCEEEEecccccccCCCcccceeE--eeeccCCCCCcccchhccc---c--cccccccccc
Q psy13776 115 TQAGDVSAYIPTNVISITDGQIFLETELFYKVDRGSINCGQLI--IGDRQTGKTALAIDTIINQ---K--RKKRRRLLKY 187 (539)
Q Consensus 115 ~~~d~v~l~~~g~~~gi~~G~~V~~tg~~~~VpVG~~LLGRVv--lG~PiDgk~~i~~~~~~~~---~--~~~r~ri~~~ 187 (539)
|+|+++++|+...|++|+.|++||+.+.||||++|+|||+ +|+|+||++++..+...+. . ...|+.+ +
T Consensus 69 ---d~VG~vi~g~~~~i~eG~~v~~Tg~i~~Vpvg~~llGRVVn~lG~pidgkg~i~~~~~~~~e~~Apgv~~RksV--~ 143 (504)
T COG0056 69 ---DSVGAVILGDYSDIKEGDEVKRTGRILEVPVGEELLGRVVDALGNPIDGKGPIDATKTRPVEKKAPGVMDRKSV--N 143 (504)
T ss_pred ---cceeEEEecCCccccCCcEEEeeCceEEEecchhhcceeecCCCCccCCCCCccccccCccccccCceeccccc--C
Confidence 9999999999999999999999999999999999999999 9999999999976654331 1 3455556 9
Q ss_pred ccccccceeeeeeeeccccceeeeeccCCCCchHhHHHHHHHhhhhccccccccccccCCCccccccccCcchhhhhhhh
Q psy13776 188 NLLSAGIKAVDSLVPIGRGQRELIIGDRQTGKTALAIDTIINQKSIYAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDL 267 (539)
Q Consensus 188 epl~TGIraID~l~pIGrGQR~lI~g~~gtGKTtLa~~~I~nq~~~~~~~~~~la~~~g~~~~e~~~d~~~~~~~i~d~~ 267 (539)
|||+|||++||+|+|||||||++|+||+|||||++|+|+|+||+..
T Consensus 144 ePlqTGikaIDamiPIGRGQRELIIGDRQTGKTaIAidtIiNQk~~---------------------------------- 189 (504)
T COG0056 144 EPLQTGIKAIDALIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGS---------------------------------- 189 (504)
T ss_pred chhhhhhHHHhhhcccCCCceEEEeccCcCCcchhhHHHHHhcccC----------------------------------
Confidence 9999999999999999999999999999999999999999999854
Q ss_pred hhHHHHhhhcccCceEEEEEeeccchhHHHHHHHHHhcCCCCceEEEEEecCCCChhhhhhhhHHHHHHHHHHHHCCCcE
Q psy13776 268 SKQAVAYRQDEKKKLYCIYVAIGQKRSTVAQIVKRLTDSGAMGYTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGKHA 347 (539)
Q Consensus 268 ~~~a~~~~~~~~~~~~~Vy~~IGer~~ev~e~~~~l~~~~~~~~tvvV~atad~~a~~r~~ap~~a~tiAEyFrd~GkdV 347 (539)
+++|||||||||.++|++++++|+++|+|+||+||+|+++||+++||+|||+|||||||||++|+||
T Consensus 190 -------------~v~CIYVAIGQK~stva~vv~tL~e~gAmdyTiVV~AsASd~a~lqYLaPy~g~a~aE~f~~~G~dv 256 (504)
T COG0056 190 -------------GVKCIYVAIGQKRSTVANVVRTLEEHGAMDYTIVVAASASDSAPLQYLAPYAGCAMAEYFRDNGKDV 256 (504)
T ss_pred -------------CcEEEEEEcccchHHHHHHHHHHHHcCCccceEEEEecCCcchhhhhhhhhhhhHHHHHHHhcCCeE
Confidence 5899999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEecChhHHHHHhHHhhhccCCCCCCCCCCCchhhchhHHHHhhhcccCCCCCccceeeeEEEeeCCCcCCcccccccc
Q psy13776 348 LIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKMSEAHGGGSLTALPVIETQAGDVSAYIPTNVIS 427 (539)
Q Consensus 348 Lli~DslTr~A~A~Reisl~lgepP~r~gyPg~vf~~~srLlERag~~~~~~g~GSITal~~v~~~~~D~s~pIp~~~~s 427 (539)
|+||||||+||.|||||||+++||||||+|||||||+||||||||+++++++|+|||||+|+++|++||+|+|||+|++|
T Consensus 257 LIVyDDLsKhA~AYReiSLLlrRPPGREAyPGDVFYlHSrLLERAakl~~e~g~GSiTALPIIETqagDvSAyIpTNVIS 336 (504)
T COG0056 257 LIVYDDLSKHAVAYREISLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETQAGDVSAYIPTNVIS 336 (504)
T ss_pred EEEecCchHHHHHHHHHHHHhcCCCCccCCCCceeehhHHHHHHHHhhccccCCCceEeeeeEEeccCceeeecccceEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccceeEEeehhHHhccCcCCCCCCCcccEEecccccccccceeeeccceeecccccccchhhccccCCCccccccccccc
Q psy13776 428 ITDGQIFLETELFYKGMALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGIRPAINVGLSVSR 507 (539)
Q Consensus 428 itDGqIvLsr~La~~g~~~~l~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~~l~~v~~~lg~~Pai~v~~s~sr 507 (539)
||||||||+.+||++| ++||||+|+||||
T Consensus 337 ITDGQIfl~t~LFn~G---------------------------------------------------~rPAInvGlSVSR 365 (504)
T COG0056 337 ITDGQIFLETDLFNAG---------------------------------------------------IRPAINVGLSVSR 365 (504)
T ss_pred ecCCcEEeehhhhhcC---------------------------------------------------CCccccCCceeec
Confidence 9999999999999999 8999999999999
Q ss_pred cCchhhhHHHHHhh-hhhhHHHHHHHhhhh
Q psy13776 508 VGSAAQTRAMKQTG-KIRSWNGWLSLLKQL 536 (539)
Q Consensus 508 ~~~~~~~~~~~~~~-~~r~~~~~~~~~~~~ 536 (539)
||+++|+++|||++ .+|. .|+.|+|+
T Consensus 366 vGssAQ~kamkkvag~lrl---~laqYrel 392 (504)
T COG0056 366 VGSAAQIKAMKKVAGSLRL---ILAQYREL 392 (504)
T ss_pred cchHHHHHHHHHHHHHHHH---HHHHHHHH
Confidence 99999999996655 5555 88888876
|
|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >PRK13343 F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >PRK09281 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK07165 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >PRK04196 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >PRK02118 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK04192 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06315 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >PRK14698 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1353|consensus | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG1351|consensus | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG1350|consensus | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >KOG1352|consensus | Back alignment and domain information |
|---|
| >COG1158 Rho Transcription termination factor [Transcription] | Back alignment and domain information |
|---|
| >COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1353|consensus | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07165 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >PRK13343 F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09281 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PF02874 ATP-synt_ab_N: ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK04196 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK02118 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK06315 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK04192 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >PRK14698 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 539 | ||||
| 2w6e_A | 553 | Low Resolution Structures Of Bovine Mitochondrial F | 1e-114 | ||
| 2w6e_A | 553 | Low Resolution Structures Of Bovine Mitochondrial F | 2e-23 | ||
| 2jiz_A | 510 | The Structure Of F1-Atpase Inhibited By Resveratrol | 1e-114 | ||
| 2jiz_A | 510 | The Structure Of F1-Atpase Inhibited By Resveratrol | 3e-23 | ||
| 1cow_A | 510 | Bovine Mitochondrial F1-Atpase Complexed With Aurov | 1e-114 | ||
| 1cow_A | 510 | Bovine Mitochondrial F1-Atpase Complexed With Aurov | 3e-23 | ||
| 1bmf_A | 510 | Bovine Mitochondrial F1-Atpase Length = 510 | 1e-114 | ||
| 1bmf_A | 510 | Bovine Mitochondrial F1-Atpase Length = 510 | 3e-23 | ||
| 2xnd_A | 492 | Crystal Structure Of Bovine F1-C8 Sub-Complex Of At | 1e-114 | ||
| 2xnd_A | 492 | Crystal Structure Of Bovine F1-C8 Sub-Complex Of At | 4e-23 | ||
| 1ohh_B | 487 | Bovine Mitochondrial F1-Atpase Complexed With The I | 1e-114 | ||
| 1ohh_B | 487 | Bovine Mitochondrial F1-Atpase Complexed With The I | 4e-23 | ||
| 2f43_A | 510 | Rat Liver F1-atpase Length = 510 | 1e-113 | ||
| 2f43_A | 510 | Rat Liver F1-atpase Length = 510 | 9e-23 | ||
| 1mab_A | 510 | Rat Liver F1-Atpase Length = 510 | 1e-113 | ||
| 1mab_A | 510 | Rat Liver F1-Atpase Length = 510 | 1e-22 | ||
| 2xok_A | 545 | Refined Structure Of Yeast F1c10 Atpase Complex To | 1e-101 | ||
| 2xok_A | 545 | Refined Structure Of Yeast F1c10 Atpase Complex To | 2e-18 | ||
| 3oee_A | 510 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 1e-101 | ||
| 3oee_A | 510 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 2e-18 | ||
| 2hld_A | 510 | Crystal Structure Of Yeast Mitochondrial F1-Atpase | 1e-101 | ||
| 2hld_A | 510 | Crystal Structure Of Yeast Mitochondrial F1-Atpase | 2e-18 | ||
| 3ofn_A | 510 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 1e-101 | ||
| 3ofn_A | 510 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 4e-17 | ||
| 4b2q_B | 486 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 1e-100 | ||
| 4b2q_B | 486 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 3e-18 | ||
| 4b2q_A | 485 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 1e-100 | ||
| 4b2q_A | 485 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 3e-18 | ||
| 2qe7_A | 502 | Crystal Structure Of The F1-Atpase From The Thermoa | 2e-90 | ||
| 2qe7_A | 502 | Crystal Structure Of The F1-Atpase From The Thermoa | 5e-12 | ||
| 1sky_B | 502 | Crystal Structure Of The Nucleotide Free Alpha3beta | 3e-87 | ||
| 1sky_B | 502 | Crystal Structure Of The Nucleotide Free Alpha3beta | 5e-12 | ||
| 3oaa_A | 513 | Structure Of The E.Coli F1-Atp Synthase Inhibited B | 2e-85 | ||
| 3oaa_A | 513 | Structure Of The E.Coli F1-Atp Synthase Inhibited B | 2e-07 | ||
| 2r9v_A | 515 | Crystal Structure Of Atp Synthase Subunit Alpha (Tm | 1e-83 | ||
| 2r9v_A | 515 | Crystal Structure Of Atp Synthase Subunit Alpha (Tm | 3e-12 | ||
| 1fx0_A | 507 | Crystal Structure Of The Chloroplast F1-Atpase From | 8e-83 | ||
| 1fx0_A | 507 | Crystal Structure Of The Chloroplast F1-Atpase From | 2e-09 | ||
| 2dpy_A | 438 | Crystal Structure Of The Flagellar Type Iii Atpase | 4e-14 | ||
| 3vr6_D | 465 | Crystal Structure Of Amp-pnp Bound Enterococcus Hir | 2e-12 | ||
| 2rkw_A | 469 | Intermediate Position Of Atp On Its Trail To The Bi | 4e-12 | ||
| 3tgw_A | 460 | Crystal Structure Of Subunit B Mutant H156a Of The | 4e-12 | ||
| 3ssa_A | 460 | Crystal Structure Of Subunit B Mutant N157t Of The | 4e-12 | ||
| 2c61_A | 469 | Crystal Structure Of The Non-Catalytic B Subunit Of | 4e-12 | ||
| 3tiv_A | 460 | Crystal Structure Of Subunit B Mutant N157a Of The | 4e-12 | ||
| 3vr2_D | 465 | Crystal Structure Of Nucleotide-free A3b3 Complex F | 8e-12 | ||
| 3vr6_A | 600 | Crystal Structure Of Amp-pnp Bound Enterococcus Hir | 2e-11 | ||
| 3gqb_B | 464 | Crystal Structure Of The A3b3 Complex From V-atpase | 8e-11 | ||
| 2obl_A | 347 | Structural And Biochemical Analysis Of A Prototypic | 1e-10 | ||
| 3a5c_D | 478 | Inter-Subunit Interaction And Quaternary Rearrangem | 1e-10 | ||
| 3vr2_A | 600 | Crystal Structure Of Nucleotide-free A3b3 Complex F | 5e-10 | ||
| 3m4y_A | 588 | Structural Characterization Of The Subunit A Mutant | 5e-08 | ||
| 3se0_A | 588 | Structural Characterization Of The Subunit A Mutant | 5e-08 | ||
| 3sdz_A | 588 | Structural Characterization Of The Subunit A Mutant | 5e-08 | ||
| 1vdz_A | 588 | Crystal Structure Of A-Type Atpase Catalytic Subuni | 5e-08 | ||
| 3nd8_A | 588 | Structural Characterization For The Nucleotide Bind | 6e-08 | ||
| 3qjy_A | 588 | Crystal Structure Of P-Loop G234a Mutant Of Subunit | 6e-08 | ||
| 3qia_A | 588 | Crystal Structure Of P-Loop G237a Mutant Of Subunit | 6e-08 | ||
| 3ikj_A | 588 | Structural Characterization For The Nucleotide Bind | 6e-08 | ||
| 3nd9_A | 588 | Structural Characterization For The Nucleotide Bind | 6e-08 | ||
| 3i4l_A | 588 | Structural Characterization For The Nucleotide Bind | 6e-08 | ||
| 3mfy_A | 588 | Structural Characterization Of The Subunit A Mutant | 6e-08 | ||
| 3qg1_A | 588 | Crystal Structure Of P-Loop G239a Mutant Of Subunit | 6e-08 | ||
| 3a5c_A | 578 | Inter-Subunit Interaction And Quaternary Rearrangem | 4e-07 | ||
| 3gqb_A | 578 | Crystal Structure Of The A3b3 Complex From V-atpase | 6e-07 | ||
| 1sky_E | 473 | Crystal Structure Of The Nucleotide Free Alpha3beta | 1e-05 | ||
| 3oaa_D | 459 | Structure Of The E.Coli F1-Atp Synthase Inhibited B | 3e-05 | ||
| 2qe7_D | 462 | Crystal Structure Of The F1-Atpase From The Thermoa | 3e-05 |
| >pdb|2W6E|A Chain A, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 553 | Back alignment and structure |
|
| >pdb|2W6E|A Chain A, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 553 | Back alignment and structure |
| >pdb|2JIZ|A Chain A, The Structure Of F1-Atpase Inhibited By Resveratrol. Length = 510 | Back alignment and structure |
| >pdb|2JIZ|A Chain A, The Structure Of F1-Atpase Inhibited By Resveratrol. Length = 510 | Back alignment and structure |
| >pdb|1COW|A Chain A, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 510 | Back alignment and structure |
| >pdb|1COW|A Chain A, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 510 | Back alignment and structure |
| >pdb|1BMF|A Chain A, Bovine Mitochondrial F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|1BMF|A Chain A, Bovine Mitochondrial F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|2XND|A Chain A, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 492 | Back alignment and structure |
| >pdb|2XND|A Chain A, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 492 | Back alignment and structure |
| >pdb|1OHH|B Chain B, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 487 | Back alignment and structure |
| >pdb|1OHH|B Chain B, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 487 | Back alignment and structure |
| >pdb|2F43|A Chain A, Rat Liver F1-atpase Length = 510 | Back alignment and structure |
| >pdb|2F43|A Chain A, Rat Liver F1-atpase Length = 510 | Back alignment and structure |
| >pdb|1MAB|A Chain A, Rat Liver F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|1MAB|A Chain A, Rat Liver F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|2XOK|A Chain A, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 545 | Back alignment and structure |
| >pdb|2XOK|A Chain A, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 545 | Back alignment and structure |
| >pdb|3OEE|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s Length = 510 | Back alignment and structure |
| >pdb|3OEE|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s Length = 510 | Back alignment and structure |
| >pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|3OFN|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i Length = 510 | Back alignment and structure |
| >pdb|3OFN|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i Length = 510 | Back alignment and structure |
| >pdb|4B2Q|B Chain B, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 486 | Back alignment and structure |
| >pdb|4B2Q|B Chain B, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 486 | Back alignment and structure |
| >pdb|4B2Q|A Chain A, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 485 | Back alignment and structure |
| >pdb|4B2Q|A Chain A, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 485 | Back alignment and structure |
| >pdb|2QE7|A Chain A, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 502 | Back alignment and structure |
| >pdb|2QE7|A Chain A, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 502 | Back alignment and structure |
| >pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 502 | Back alignment and structure |
| >pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 502 | Back alignment and structure |
| >pdb|3OAA|A Chain A, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 513 | Back alignment and structure |
| >pdb|3OAA|A Chain A, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 513 | Back alignment and structure |
| >pdb|2R9V|A Chain A, Crystal Structure Of Atp Synthase Subunit Alpha (Tm1612) From Thermotoga Maritima At 2.10 A Resolution Length = 515 | Back alignment and structure |
| >pdb|2R9V|A Chain A, Crystal Structure Of Atp Synthase Subunit Alpha (Tm1612) From Thermotoga Maritima At 2.10 A Resolution Length = 515 | Back alignment and structure |
| >pdb|1FX0|A Chain A, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 507 | Back alignment and structure |
| >pdb|1FX0|A Chain A, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 507 | Back alignment and structure |
| >pdb|2DPY|A Chain A, Crystal Structure Of The Flagellar Type Iii Atpase Flii Length = 438 | Back alignment and structure |
| >pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 | Back alignment and structure |
| >pdb|2RKW|A Chain A, Intermediate Position Of Atp On Its Trail To The Binding Pocket Inside The Subunit B Mutant R416w Of The Energy Converter A1ao Atp Synthase Length = 469 | Back alignment and structure |
| >pdb|3TGW|A Chain A, Crystal Structure Of Subunit B Mutant H156a Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|3SSA|A Chain A, Crystal Structure Of Subunit B Mutant N157t Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|2C61|A Chain A, Crystal Structure Of The Non-Catalytic B Subunit Of A-Type Atpase From M. Mazei Go1 Length = 469 | Back alignment and structure |
| >pdb|3TIV|A Chain A, Crystal Structure Of Subunit B Mutant N157a Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 | Back alignment and structure |
| >pdb|3VR6|A Chain A, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 600 | Back alignment and structure |
| >pdb|3GQB|B Chain B, Crystal Structure Of The A3b3 Complex From V-atpase Length = 464 | Back alignment and structure |
| >pdb|2OBL|A Chain A, Structural And Biochemical Analysis Of A Prototypical Atpase From The Type Iii Secretion System Of Pathogenic Bacteria Length = 347 | Back alignment and structure |
| >pdb|3A5C|D Chain D, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 478 | Back alignment and structure |
| >pdb|3VR2|A Chain A, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 600 | Back alignment and structure |
| >pdb|3M4Y|A Chain A, Structural Characterization Of The Subunit A Mutant P235a Of The A-Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3SE0|A Chain A, Structural Characterization Of The Subunit A Mutant F508w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|3SDZ|A Chain A, Structural Characterization Of The Subunit A Mutant F427w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|1VDZ|A Chain A, Crystal Structure Of A-Type Atpase Catalytic Subunit A From Pyrococcus Horikoshii Ot3 Length = 588 | Back alignment and structure |
| >pdb|3ND8|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QJY|A Chain A, Crystal Structure Of P-Loop G234a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QIA|A Chain A, Crystal Structure Of P-Loop G237a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3IKJ|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Mutant S238a Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3ND9|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3I4L|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A With Amp-Pnp Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3MFY|A Chain A, Structural Characterization Of The Subunit A Mutant F236a Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|3QG1|A Chain A, Crystal Structure Of P-Loop G239a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3A5C|A Chain A, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 578 | Back alignment and structure |
| >pdb|3GQB|A Chain A, Crystal Structure Of The A3b3 Complex From V-atpase Length = 578 | Back alignment and structure |
| >pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 473 | Back alignment and structure |
| >pdb|3OAA|D Chain D, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 459 | Back alignment and structure |
| >pdb|2QE7|D Chain D, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 462 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 539 | |||
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 1e-177 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 1e-65 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 1e-25 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 1e-173 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 5e-65 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 6e-38 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 2e-25 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 1e-173 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 7e-63 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 7e-39 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 8e-26 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 1e-172 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 4e-65 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 8e-38 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 3e-25 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 1e-172 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 5e-65 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 4e-38 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 2e-25 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 9e-30 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 3e-12 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 7e-05 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 4e-27 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 9e-12 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 8e-06 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 6e-18 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 3e-06 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 3e-05 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 4e-04 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 3e-17 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 1e-05 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 5e-05 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 4e-17 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 2e-14 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-08 |
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 | Back alignment and structure |
|---|
Score = 507 bits (1307), Expect = e-177
Identities = 219/336 (65%), Positives = 232/336 (69%), Gaps = 91/336 (27%)
Query: 190 LSAGIKAVDSLVPIGRGQRELIIGDRQTGKTALAIDTIINQKSIYAAPLQYLAPYSGCAM 249
+ GIKAVDSLVPIGRGQRELIIGDRQTGKT++AIDTIINQK
Sbjct: 146 MQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDG------------- 192
Query: 250 GEFFRDNGKHALIIYDDLSKQAVAYRQDEKKKLYCIYVAIGQKRSTVAQIVKRLTDSGAM 309
DEKKKLYCIYVAIGQKRSTVAQ+VKRLTD+ AM
Sbjct: 193 --------------------------TDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAM 226
Query: 310 GYTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQMSLLLR 369
YTI+VSATASDAAPLQYLAPYSGC+MGE+FRDNGKHALIIYDDLSKQAVAYRQMSLLLR
Sbjct: 227 KYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR 286
Query: 370 RPPGREAYPGDVFYLHSRLLERSAKMSEAHGGGSLTALPVIETQAGDVSAYIPTNVISIT 429
RPPGREAYPGDVFYLHSRLLER+AKM++A GGGSLTALPVIETQAGDVSAYIPTNVISIT
Sbjct: 287 RPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISIT 346
Query: 430 DGQIFLETELFYKGMALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRV 489
DGQIFLETELFYK
Sbjct: 347 DGQIFLETELFYK----------------------------------------------- 359
Query: 490 VDALGIRPAINVGLSVSRVGSAAQTRAMKQ-TGKIR 524
GIRPAINVGLSVSRVGSAAQTRAMKQ G ++
Sbjct: 360 ----GIRPAINVGLSVSRVGSAAQTRAMKQVAGTMK 391
|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 539 | |||
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 100.0 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 100.0 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 100.0 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 100.0 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 100.0 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 100.0 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 100.0 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 100.0 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 100.0 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 100.0 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 100.0 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 100.0 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 100.0 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 100.0 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 100.0 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 100.0 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 100.0 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 100.0 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 98.51 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 98.39 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 98.36 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 98.35 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 98.33 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 97.98 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 97.95 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 97.9 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 97.88 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 97.59 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 97.59 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 97.59 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 97.51 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 97.5 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 97.48 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 97.21 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 97.03 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.71 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.66 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.56 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 96.41 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 96.38 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 96.38 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 96.33 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 96.29 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.18 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 96.11 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.07 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.04 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 95.63 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 95.59 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 95.56 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 95.33 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 95.31 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 95.31 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 95.05 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 94.79 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 94.79 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 94.73 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 94.73 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 94.58 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 94.57 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 94.52 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 94.44 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 94.41 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 94.34 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 94.07 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 93.83 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 93.8 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 93.7 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 93.64 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 93.49 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 93.47 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 93.47 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 93.44 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 93.42 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 92.97 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 92.73 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 92.69 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 92.5 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 92.45 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 92.41 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 92.34 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 92.3 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 92.11 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 91.9 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 91.88 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 91.85 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 91.85 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 91.75 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 91.73 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 91.62 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 91.62 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 91.51 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 91.43 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 91.42 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 91.39 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 91.38 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 91.33 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 91.24 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 91.23 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 91.23 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 91.22 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 91.16 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 91.16 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 91.15 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 91.13 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 91.09 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 91.05 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 91.05 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 91.05 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 91.03 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 91.0 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 90.9 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 90.9 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 90.76 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 90.73 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 90.48 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 90.37 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 90.23 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 90.22 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 90.21 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 90.21 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 90.18 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 90.16 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 90.05 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 90.04 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 90.03 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 90.01 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 90.0 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 89.94 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 89.87 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 89.84 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 89.84 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 89.71 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 89.69 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 89.69 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 89.57 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 89.57 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 89.46 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 89.4 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 89.35 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 89.32 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 89.29 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 89.27 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 89.2 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 89.01 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 88.9 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 88.82 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 88.8 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 88.77 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 88.76 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 88.75 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 88.66 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 88.54 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 88.45 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 88.16 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 88.12 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 87.95 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 87.92 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 87.84 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 87.73 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 87.73 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 87.64 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 87.59 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 87.48 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 87.48 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 87.43 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 87.34 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 87.06 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 87.0 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 86.98 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 86.93 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 86.91 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 86.76 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 86.5 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 86.41 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 86.09 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 86.07 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 86.07 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 86.06 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 86.05 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 86.02 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 86.0 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 85.97 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 85.87 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 85.87 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 85.87 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 85.82 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 85.71 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 85.67 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 85.24 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 84.97 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 84.9 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 84.8 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 84.7 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 84.42 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 84.23 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 84.07 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 84.07 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 84.07 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 83.89 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 83.77 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 83.53 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 83.45 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 83.39 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 83.37 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 83.34 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 83.33 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 83.27 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 83.19 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 83.06 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 83.03 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 82.99 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 82.95 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 82.85 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 82.78 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 82.65 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 82.53 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 82.5 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 82.49 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 82.37 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 82.31 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 82.25 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 82.01 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 82.0 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 81.98 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 81.89 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 81.81 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 81.8 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 81.8 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 81.72 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 81.68 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 81.59 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 81.54 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 81.5 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 81.45 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 81.34 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 81.25 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 81.24 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 81.23 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 81.19 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 81.16 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 81.16 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 81.13 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 81.11 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 81.03 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 80.97 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 80.91 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 80.91 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 80.91 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 80.9 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 80.88 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 80.63 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 80.63 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 80.63 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 80.56 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 80.51 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 80.51 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 80.5 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 80.48 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 80.46 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 80.43 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 80.38 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 80.38 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 80.38 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 80.38 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 80.27 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 80.21 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 80.19 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 80.18 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 80.09 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 80.04 |
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
Probab=100.00 E-value=6.8e-107 Score=872.47 Aligned_cols=382 Identities=53% Similarity=0.774 Sum_probs=335.5
Q ss_pred CCChHHHHHHHHHHHhcCcchhhhhhhhcccccccCceeeecCCe----eEEccchhhhhcccccccCCeEEEEEecccc
Q psy13776 40 SSRAAEISSILEERILGSAPKAVAYRQMSLLLRRPPGREAYPGDV----FYLHSRLLERSAKMSEAHGGGSLTALPVIET 115 (539)
Q Consensus 40 ~~~~~ei~~~l~~~i~~~~~~~~~~~ei~g~~~e~~G~v~~IGDg----~gL~~~~~~~~gEVV~f~~g~~G~vl~l~~~ 115 (539)
+++++||+++++++|.+|++.+.. ++.|++.+|+++ +|+.++ .++|++.|+++..|+|+++++
T Consensus 2 ~~~~~~~~~~~~~~i~~~~~~~~~---------~~~G~V~~v~g~i~~v~Gl~~~---~~gElv~~~~~~~g~v~~l~~- 68 (513)
T 3oaa_A 2 QLNSTEISELIKQRIAQFNVVSEA---------HNEGTIVSVSDGVIRIHGLADC---MQGEMISLPGNRYAIALNLER- 68 (513)
T ss_dssp ----------------------CC---------TTEEEEEEEETTEEEEEECTTC---BTTCEEEETTTEEEEEEEECS-
T ss_pred CCCHHHHHHHHHHHHHhcCCCCCc---------eeEEEEEEEECcEEEEECCccC---CcCCEEEECCCCEEEEEEeeC-
Confidence 567899999999999999988877 889999999999 677777 999999999999999999999
Q ss_pred CCCcEEEEcccCCcCCCCCCEEEEecccccccCCCcccceeE--eeeccCCCCCcccchhcc---ccccccccccccccc
Q psy13776 116 QAGDVSAYIPTNVISITDGQIFLETELFYKVDRGSINCGQLI--IGDRQTGKTALAIDTIIN---QKRKKRRRLLKYNLL 190 (539)
Q Consensus 116 ~~d~v~l~~~g~~~gi~~G~~V~~tg~~~~VpVG~~LLGRVv--lG~PiDgk~~i~~~~~~~---~~~~~r~ri~~~epl 190 (539)
|++++++|+++.|+++|++|++||++++||||++|||||+ +|+||||++++..+...+ .+|++..|.++++||
T Consensus 69 --d~v~~~~~~~~~gi~~G~~V~~tg~~~~VpvG~~lLGRV~d~lG~PiDg~g~i~~~~~~pi~~~ap~~~~R~~v~epl 146 (513)
T 3oaa_A 69 --DSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLLGRVVNTLGAPIDGKGPLDHDGFSAVEAIAPGVIERQSVDQPV 146 (513)
T ss_dssp --SCEEEEESSCCSSCCTTCEEECCSCSSEEECSGGGTTCEEETTSCBTTCSCSCCCSCEEESSCCCCCSSSCCCCCCBC
T ss_pred --CEEEEEEeCCccCCCCCCEEEEcCCCCeEeeCHHHhccchhhcCcCccCCCCCCccceeecccCCCCccccCCcCccc
Confidence 9999999999999999999999999999999999999999 999999999987665432 234444454559999
Q ss_pred cccceeeeeeeeccccceeeeeccCCCCchHhHHHHHHHhhhhccccccccccccCCCccccccccCcchhhhhhhhhhH
Q psy13776 191 SAGIKAVDSLVPIGRGQRELIIGDRQTGKTALAIDTIINQKSIYAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQ 270 (539)
Q Consensus 191 ~TGIraID~l~pIGrGQR~lI~g~~gtGKTtLa~~~I~nq~~~~~~~~~~la~~~g~~~~e~~~d~~~~~~~i~d~~~~~ 270 (539)
+||||+||+|+|||||||++|||++|||||+|++++|+||+..
T Consensus 147 ~TGikaID~l~PigrGQR~~Ifg~~g~GKT~l~l~~I~n~~~~------------------------------------- 189 (513)
T 3oaa_A 147 QTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAIDAIINQRDS------------------------------------- 189 (513)
T ss_dssp CCSCHHHHHHSCCBTTCBCEEEESSSSSHHHHHHHHHHTTSSS-------------------------------------
T ss_pred ccceeeeccccccccCCEEEeecCCCCCcchHHHHHHHhhccC-------------------------------------
Confidence 9999999999999999999999999999999999999998643
Q ss_pred HHHhhhcccCceEEEEEeeccchhHHHHHHHHHhcCCCCceEEEEEecCCCChhhhhhhhHHHHHHHHHHHHCCCcEEEE
Q psy13776 271 AVAYRQDEKKKLYCIYVAIGQKRSTVAQIVKRLTDSGAMGYTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGKHALII 350 (539)
Q Consensus 271 a~~~~~~~~~~~~~Vy~~IGer~~ev~e~~~~l~~~~~~~~tvvV~atad~~a~~r~~ap~~a~tiAEyFrd~GkdVLli 350 (539)
+++|||++||||++||++|+++++++|+|+||++|++|+|+||.+|+++||+|||+||||||+|+|||++
T Consensus 190 ----------dv~~V~~~IGeR~~ev~e~~~~l~~~g~m~~tvvV~atad~p~~~r~~a~~~a~tiAEyfrd~G~dVLli 259 (513)
T 3oaa_A 190 ----------GIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPYAGCAMGEYFRDRGEDALII 259 (513)
T ss_dssp ----------SCEEEEEEESCCHHHHHHHHHHHHHHSCSTTEEEEEECTTSCHHHHHHHHHHHHHHHHHHHHTTCEEEEE
T ss_pred ----------CceEEEEEecCChHHHHHHHHHHhhcCcccceEEEEECCCCChHHHHHHHHHHHHHHHHHHhcCCCEEEE
Confidence 4789999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ecChhHHHHHhHHhhhccCCCCCCCCCCCchhhchhHHHHhhhcccCC----------CC-CccceeeeEEEeeCCCcCC
Q psy13776 351 YDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKMSEA----------HG-GGSLTALPVIETQAGDVSA 419 (539)
Q Consensus 351 ~DslTr~A~A~Reisl~lgepP~r~gyPg~vf~~~srLlERag~~~~~----------~g-~GSITal~~v~~~~~D~s~ 419 (539)
|||+||||+||||||+++||||+++|||||+||+||||+||||++++. .| +||||+||+|++|+||++|
T Consensus 260 ~Dsltr~A~A~REisl~lgepP~r~gYP~~vf~~~srLlERAg~~~~~~~~~~~~~~~~g~~GSITal~~V~~~~dD~s~ 339 (513)
T 3oaa_A 260 YDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLERAARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSA 339 (513)
T ss_dssp EETHHHHHHHHHHHHHHTTCCBCTTSCBTTHHHHHHHHHTTCSEECHHHHHHHHTTSCCSCCEEEEECCEEECGGGCCSS
T ss_pred ecChHHHHHHHHHHHHhcCCCCcccCCCchhhhhcchHHHHHhhcccccchhccccccCCCCcceEEEEEEEcCCCCccC
Confidence 999999999999999999999999999999999999999999998632 35 8999999999999999999
Q ss_pred ccccccccccceeEEeehhHHhccCcCCCCCCCcccEEecccccccccceeeeccceeecccccccchhhccccCCCccc
Q psy13776 420 YIPTNVISITDGQIFLETELFYKGMALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGIRPAI 499 (539)
Q Consensus 420 pIp~~~~sitDGqIvLsr~La~~g~~~~l~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~~l~~v~~~lg~~Pai 499 (539)
|||||++|||||||||||+||++| +||||
T Consensus 340 pIp~~~~si~DGqIvLsr~La~~g---------------------------------------------------iyPAI 368 (513)
T 3oaa_A 340 FVPTNVISITDGQIFLETNLFNAG---------------------------------------------------IRPAV 368 (513)
T ss_dssp HHHHHHHHHSSEEEEECHHHHTTS---------------------------------------------------CCSCB
T ss_pred cchHhhhccCCeEEEEehhHHhCC---------------------------------------------------CCCcc
Confidence 999999999999999999999999 79999
Q ss_pred cccccccccCchhhhHHH-HHhhhhhhHHHHHHHhhhhh
Q psy13776 500 NVGLSVSRVGSAAQTRAM-KQTGKIRSWNGWLSLLKQLY 537 (539)
Q Consensus 500 ~v~~s~sr~~~~~~~~~~-~~~~~~r~~~~~~~~~~~~~ 537 (539)
|++.|+||+|+++|+++| +.+.++|+ +|+.|+|+.
T Consensus 369 dvl~SvSRv~~~~~~~~~~~va~~lr~---~la~y~el~ 404 (513)
T 3oaa_A 369 NPGISVSRVGGAAQTKIMKKLSGGIRT---ALAQYRELA 404 (513)
T ss_dssp CTTTCEESSGGGGSCHHHHHHHHHHHH---HHHHHHHHH
T ss_pred CccccccccCcccccHHHHHHHHHHHH---HHHHHHHHH
Confidence 999999999999999999 45666777 899999873
|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 539 | ||||
| d2jdia3 | 285 | c.37.1.11 (A:95-379) Central domain of alpha subun | 2e-92 | |
| d2jdia3 | 285 | c.37.1.11 (A:95-379) Central domain of alpha subun | 8e-33 | |
| d2jdia3 | 285 | c.37.1.11 (A:95-379) Central domain of alpha subun | 3e-04 | |
| d2jdid3 | 276 | c.37.1.11 (D:82-357) Central domain of beta subuni | 9e-75 | |
| d2jdid3 | 276 | c.37.1.11 (D:82-357) Central domain of beta subuni | 1e-27 | |
| d2jdid3 | 276 | c.37.1.11 (D:82-357) Central domain of beta subuni | 0.002 | |
| d1fx0a3 | 276 | c.37.1.11 (A:97-372) Central domain of alpha subun | 5e-72 | |
| d1fx0a3 | 276 | c.37.1.11 (A:97-372) Central domain of alpha subun | 1e-31 | |
| d1fx0a3 | 276 | c.37.1.11 (A:97-372) Central domain of alpha subun | 9e-04 | |
| d1xpua3 | 289 | c.37.1.11 (A:129-417) Transcription termination fa | 1e-38 | |
| d1xpua3 | 289 | c.37.1.11 (A:129-417) Transcription termination fa | 3e-12 | |
| d1xpua3 | 289 | c.37.1.11 (A:129-417) Transcription termination fa | 4e-08 | |
| d1skyb2 | 75 | b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, | 4e-12 | |
| d2jdia2 | 71 | b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, | 5e-12 | |
| d1fx0a2 | 72 | b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, | 4e-11 |
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: Central domain of alpha subunit of F1 ATP synthase species: Cow (Bos taurus) [TaxId: 9913]
Score = 282 bits (722), Expect = 2e-92
Identities = 213/331 (64%), Positives = 225/331 (67%), Gaps = 90/331 (27%)
Query: 183 RLLKYNLLSAGIKAVDSLVPIGRGQRELIIGDRQTGKTALAIDTIINQKSIYAAPLQYLA 242
R+ + GIKAVDSLVPIGRGQRELIIGDRQTGKT++AIDTIINQK
Sbjct: 45 RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDG------ 98
Query: 243 PYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQDEKKKLYCIYVAIGQKRSTVAQIVKR 302
DEKKKLYCIYVAIGQKRSTVAQ+VKR
Sbjct: 99 ---------------------------------TDEKKKLYCIYVAIGQKRSTVAQLVKR 125
Query: 303 LTDSGAMGYTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYR 362
LTD+ AM YTI+VSATASDAAPLQYLAPYSGC+MGE+FRDNGKHALIIYDDLSKQAVAYR
Sbjct: 126 LTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYR 185
Query: 363 QMSLLLRRPPGREAYPGDVFYLHSRLLERSAKMSEAHGGGSLTALPVIETQAGDVSAYIP 422
QMSLLLRRPPGREAYPGDVFYLHSRLLER+AKM++A GGGSLTALPVIETQAGDVSAYIP
Sbjct: 186 QMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIP 245
Query: 423 TNVISITDGQIFLETELFYKGMALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVG 482
TNVISITDGQIFLETELFYK
Sbjct: 246 TNVISITDGQIFLETELFYK---------------------------------------- 265
Query: 483 EDLLGRVVDALGIRPAINVGLSVSRVGSAAQ 513
GIRPAINVGLSVSRVGSAAQ
Sbjct: 266 -----------GIRPAINVGLSVSRVGSAAQ 285
|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 | Back information, alignment and structure |
|---|
| >d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Length = 75 | Back information, alignment and structure |
|---|
| >d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 71 | Back information, alignment and structure |
|---|
| >d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 72 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 539 | |||
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 100.0 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 100.0 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 100.0 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 100.0 | |
| d1skyb2 | 75 | F1 ATP synthase alpha subunit, domain 1 {Bacillus | 99.26 | |
| d1fx0a2 | 72 | F1 ATP synthase alpha subunit, domain 1 {Spinach ( | 99.25 | |
| d2jdia2 | 71 | F1 ATP synthase alpha subunit, domain 1 {Cow (Bos | 99.24 | |
| d1skyb2 | 75 | F1 ATP synthase alpha subunit, domain 1 {Bacillus | 98.37 | |
| d2jdia2 | 71 | F1 ATP synthase alpha subunit, domain 1 {Cow (Bos | 98.36 | |
| d1fx0a2 | 72 | F1 ATP synthase alpha subunit, domain 1 {Spinach ( | 98.35 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.73 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.32 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 97.03 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.95 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.74 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 96.58 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 96.55 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.33 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 96.18 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.99 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 95.98 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 95.68 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 95.53 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 94.78 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.12 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 93.57 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 93.44 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 93.36 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 93.12 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 93.02 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 92.8 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 92.49 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 92.4 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 92.35 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 92.31 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 92.05 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 91.9 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 91.71 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 91.7 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 91.7 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 91.6 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 91.59 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 91.56 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 91.35 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 91.32 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.31 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 91.25 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 90.78 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 90.6 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 90.42 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 90.35 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 90.35 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 90.35 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 90.33 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 90.33 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 90.32 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 90.3 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 90.19 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 90.17 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 89.98 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 89.88 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 89.77 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 89.74 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 89.71 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 89.2 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 89.2 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 89.03 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 88.99 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 88.68 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 88.66 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 88.56 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 88.4 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 88.23 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 88.17 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 87.94 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 87.83 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 87.64 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 87.57 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 87.4 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 87.22 | |
| d1fx0b2 | 79 | F1 ATP synthase beta subunit, domain 1 {Spinach (S | 87.11 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 86.98 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 86.91 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 86.74 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 86.67 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 86.67 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 86.6 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 86.37 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 86.37 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 86.34 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 86.21 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 85.67 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 85.67 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 85.56 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 85.53 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 85.51 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 85.41 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 85.36 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 85.31 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 85.3 | |
| d1skye2 | 82 | F1 ATP synthase beta subunit, domain 1 {Bacillus s | 85.16 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 85.1 | |
| d2jdid2 | 72 | F1 ATP synthase beta subunit, domain 1 {Rat (Rattu | 85.0 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 84.96 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 84.87 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 84.84 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 84.77 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 84.77 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 84.67 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 84.6 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 84.44 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 84.42 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 84.41 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 84.38 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 84.33 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 84.32 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 84.15 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 84.05 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 84.05 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 83.91 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 83.86 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 83.82 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 83.75 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 83.64 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 83.17 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 83.16 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 83.16 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 82.87 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 82.86 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 82.78 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 82.72 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 82.69 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 82.66 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 82.64 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 82.41 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 82.29 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 81.93 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 81.86 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 81.85 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 81.79 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 81.69 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 81.64 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 81.59 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 81.58 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 81.33 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 81.26 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 81.08 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 80.97 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 80.94 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 80.93 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 80.91 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 80.68 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 80.52 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 80.43 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 80.24 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 80.2 |
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: Central domain of alpha subunit of F1 ATP synthase species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=1e-85 Score=666.03 Aligned_cols=279 Identities=79% Similarity=1.144 Sum_probs=256.1
Q ss_pred cccCCCcccceeE--eeeccCCCCCcccchhcc---ccccccccccccccccccceeeeeeeeccccceeeeeccCCCCc
Q psy13776 145 KVDRGSINCGQLI--IGDRQTGKTALAIDTIIN---QKRKKRRRLLKYNLLSAGIKAVDSLVPIGRGQRELIIGDRQTGK 219 (539)
Q Consensus 145 ~VpVG~~LLGRVv--lG~PiDgk~~i~~~~~~~---~~~~~r~ri~~~epl~TGIraID~l~pIGrGQR~lI~g~~gtGK 219 (539)
+||||++|||||+ +|+||||++++..++.++ .++++..|..+++||.||||+||+|+|||||||++|||++|+||
T Consensus 2 ~VPVG~~lLGRVid~~G~piDg~~~~~~~~~~~i~~~~p~~~~R~~i~e~l~TGIraID~l~pig~GQr~~If~~~g~GK 81 (285)
T d2jdia3 2 DVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGK 81 (285)
T ss_dssp EEEESGGGTTCEECTTSCBCSSSCCCCCSEEEESSCCCCCSTTBCCCCSBCCCSCHHHHHHSCCBTTCBCEEEESTTSSH
T ss_pred ccccCcCccCcEECCCccccCCCCCCCCCccccccCCCcCchhccCCCcccccCceEEecccCccCCCEEEeecCCCCCh
Confidence 6899999999999 999999999887655332 12333333344999999999999999999999999999999999
Q ss_pred hHhHHHHHHHhhhhccccccccccccCCCccccccccCcchhhhhhhhhhHHHHhhhcccCceEEEEEeeccchhHHHHH
Q psy13776 220 TALAIDTIINQKSIYAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQDEKKKLYCIYVAIGQKRSTVAQI 299 (539)
Q Consensus 220 TtLa~~~I~nq~~~~~~~~~~la~~~g~~~~e~~~d~~~~~~~i~d~~~~~a~~~~~~~~~~~~~Vy~~IGer~~ev~e~ 299 (539)
|+|+++++.||+... + ..+++++++|||++||||++|+.+|
T Consensus 82 t~ll~~~~~~~~~~~--------------------~-------------------~~~~~~~~~~v~~~IGer~~E~~e~ 122 (285)
T d2jdia3 82 TSIAIDTIINQKRFN--------------------D-------------------GTDEKKKLYCIYVAIGQKRSTVAQL 122 (285)
T ss_dssp HHHHHHHHHHTHHHH--------------------T-------------------SSCTTTCCEEEEEEESCCHHHHHHH
T ss_pred HHHHHHHHHhHHhhc--------------------c-------------------ccccccceEEEEeeeCccHHHHHHH
Confidence 999999999887540 0 1123456899999999999999999
Q ss_pred HHHHhcCCCCceEEEEEecCCCChhhhhhhhHHHHHHHHHHHHCCCcEEEEecChhHHHHHhHHhhhccCCCCCCCCCCC
Q psy13776 300 VKRLTDSGAMGYTIIVSATASDAAPLQYLAPYSGCAMGEFFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPG 379 (539)
Q Consensus 300 ~~~l~~~~~~~~tvvV~atad~~a~~r~~ap~~a~tiAEyFrd~GkdVLli~DslTr~A~A~Reisl~lgepP~r~gyPg 379 (539)
++.+++.++++||++|++|+|+||.+|+++||+|||+||||||+|||||+++|||||||+|+||||+++||||+++||||
T Consensus 123 ~~~~~~~~~~~~tvvv~~ts~~~~~~r~~~~~~a~tiAEyfrd~G~~VLll~Dsltr~A~A~rEis~~~ge~p~~~gyp~ 202 (285)
T d2jdia3 123 VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPG 202 (285)
T ss_dssp HHHHHHTTCGGGEEEEEECTTSCHHHHHHHHHHHHHHHHHHHHTTCEEEEEEETHHHHHHHHHHHHHHTTCCCCGGGCCT
T ss_pred HHHhcccccccceEEEEECCCCCHHHHHHHHHHHHHHHHHHHHcCCcEEEEEcChHHHHHHHHHHHHhcCCCCCcCCcCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred chhhchhHHHHhhhcccCCCCCccceeeeEEEeeCCCcCCccccccccccceeEEeehhHHhccCcCCCCCCCcccEEec
Q psy13776 380 DVFYLHSRLLERSAKMSEAHGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGMALNLEPDNVGVVVFG 459 (539)
Q Consensus 380 ~vf~~~srLlERag~~~~~~g~GSITal~~v~~~~~D~s~pIp~~~~sitDGqIvLsr~La~~g~~~~l~~~~~~~~~~~ 459 (539)
++|+.|++|+||||++++..++||||+||+|++|+||++|||||++++|+||||+|||+||++|
T Consensus 203 ~~~~~~~~l~ERag~~~~~~~~GSiT~i~~v~~~~dD~tdpI~~~~~~i~dg~ivLsr~la~~g---------------- 266 (285)
T d2jdia3 203 DVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKG---------------- 266 (285)
T ss_dssp THHHHHHHHHTTCCBBCGGGTCCEEEEEEEEECSTTCTTSHHHHHHHHHSSEEEEBCHHHHHHT----------------
T ss_pred hHHHHHHHHHHHHhcccCCCCCeeEEEEEEEEecCCCCCCchhHHHHhhcCcEEEEcHHHHhcC----------------
Confidence 9999999999999998876779999999999999999999999999999999999999999999
Q ss_pred ccccccccceeeeccceeecccccccchhhccccCCCccccccccccccCchhh
Q psy13776 460 NDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGIRPAINVGLSVSRVGSAAQ 513 (539)
Q Consensus 460 ~~~~~~~~~~~~~t~~~~~~~~~~~~l~~v~~~lg~~Pai~v~~s~sr~~~~~~ 513 (539)
+|||||++.|+||+|+++|
T Consensus 267 -----------------------------------~yPAID~l~S~SR~~~~~q 285 (285)
T d2jdia3 267 -----------------------------------IRPAINVGLSVSRVGSAAQ 285 (285)
T ss_dssp -----------------------------------CSSCBCTTTCEESSGGGGS
T ss_pred -----------------------------------CCCCcCCcccccccCcccC
Confidence 7999999999999999997
|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|