Diaphorina citri psyllid: psy13781


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
YLNGVDRSCRQVNRVLYSRYEKLYSGHKRYKKDGLTSLKYKVIDTKQHKLFTWFLVQLGELVNGFSNEYWGWGGEDDDMSNRVKAAGLQIIRYPPDIAKYSMLRHRKEKANPQRYEKLYSGHKRYKKDGLTSLKYKVIDTKQHKLFTWFLVQLGE
cccccccccEEEccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHccccccccccccccHHHHHHHHHcccCEECccccccEEEEcccccccccHHHHHHHHHHccccccccccCEEEEEEEEEEEccEEEEEEEEcc
**NG*DRSCRQVNRVLYSRYEKLYSGHKRYKKDGLTSLKYKVIDTKQHKLFTWFLVQLGELVNGFSNEYWGWGGEDDDMSNRVKAAGLQIIRYPPDIAKYSMLRHRKEKANPQRYEKLYSGHKRYKKDGLTSLKYKVIDTKQHKLFTWFLVQLGE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YLNGVDRSCRQVNRVLYSRYEKLYSGHKRYKKDGLTSLKYKVIDTKQHKLFTWFLVQLGELVNGFSNEYWGWGGEDDDMSNRVKAAGLQIIRYPPDIAKYSMLRHRKEKANPQRYEKLYSGHKRYKKDGLTSLKYKVIDTKQHKLFTWFLVQLGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0033842 [MF]N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008376, GO:0008194
GO:0035250 [MF]UDP-galactosyltransferase activityprobableGO:0003674, GO:0003824, GO:0016740, GO:0008378, GO:0016757, GO:0016758, GO:0008194
GO:0009247 [BP]glycolipid biosynthetic processprobableGO:1901576, GO:0006629, GO:0044238, GO:0006643, GO:0071704, GO:1901137, GO:1901135, GO:0009987, GO:0044710, GO:0044237, GO:0044249, GO:0009058, GO:0008150, GO:0008152, GO:0046467, GO:0044255, GO:0006664, GO:0008610
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006044 [BP]N-acetylglucosamine metabolic processprobableGO:0006040, GO:1901135, GO:0071704, GO:0008150, GO:0008152, GO:1901071

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LW6, chain A
Confidence level:very confident
Coverage over the Query: 9-154
View the alignment between query and template
View the model in PyMOL