Diaphorina citri psyllid: psy13786

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MAETEKLLGKTKKSYAHPVIATSSNAADIIDISNGEHTDTPTLFRLIYLGLIVILPGVAPGMSFGFPAVALPQMSYLTIDQASWFASISAITMPIGCLLSGPIIDKYGRKSALMITNVPSLCGWLLMATKSDLINLYISRLLSGLSVGLATTPAAVYAAECITIHNTDLRGSLSTWSTIALTSGILLSYLTGAFFWYTTVAYIGAFVSFLSLVLVAMII
cHHccHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHc
**************************************DTPTLFRLIYLGLIVILPGVAPGMSFGFPAVALPQMSYLTIDQASWFASISAITMPIGCLLSGPIIDKYGRKSALMITNVPSLCGWLLMATKSDLINLYISRLLSGLSVGLATTPAAVYAAECITIHNTDLRGSLSTWSTIALTSGILLSYLTGAFFWYTTVAYIGAFVSFLSLVLVAMII
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAETEKLLGKTKKSYAHPVIATSSNAADIIDISNGEHTDTPTLFRLIYLGLIVILPGVAPGMSFGFPAVALPQMSYLTIDQASWFASISAITMPIGCLLSGPIIDKYGRKSALMITNVPSLCGWLLMATKSDLINLYISRLLSGLSVGLATTPAAVYAAECITIHNTDLRGSLSTWSTIALTSGILLSYLTGAFFWYTTVAYIGAFVSFLSLVLVAMII

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0009705 [CC]plant-type vacuole membraneprobableGO:0005737, GO:0005575, GO:0000325, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0015149 [MF]hexose transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0051119, GO:1901476, GO:0005215, GO:0022857, GO:0003674, GO:0015145, GO:0015144

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 43-216
View the alignment between query and template
View the model in PyMOL