Diaphorina citri psyllid: psy13797


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
DHWEKEPLYISRKQKNYYNNLITSKKIDDILRDNVIEFKKNIDITLYEDGQRQTMDVEGRALPQIVWDHYREGCSIRFLNPQTYIKPLQQLNASLQELFGCFVGANTYQTPPTAQGFAPHYDDIEAFILQLEGKKKWKVYLPRMVDEYLPRYSSPNFSQEEIGTPILTVTLEPGDLLYLPRGYIHQASTVTNEHSLHVTISVYQKTAWIDLLEKAMPKALQAAGATDLEFRRGLPIGYLRYAGLARGKPVDIQADRLAMKENLKDLLAKLVEYVDLDDGVDEMGKQLMHDALPPVLSPEELQCSVFENGLRMSQTGEVYNATQITKDTKVRLVRANAVR
cccccccEEEcccccccccccccHHHHHHHHHcccccccccccEEEEcccccccccccccccHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccEEEEEEEEEEEEEEccccccccccccccccccccccccccEEEEEccccEEECccccEEEEEccccccEEEEEcccccccHHHHHHHHHHHHHHHHHccccHHHHHcccccHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEcccccc
DHWEKEPLYISRKQKNYYNNLITSKKIDDILRDNVIEFKKNIDITLYEDGQRQTMDVEGRALPQIVWDHYREGCSIRFLNPQTYIKPLQQLNASLQELFGCFVGANTYQTPPTAQGFAPHYDDIEAFILQLEGKKKWKVYLPRMVDEYLPRYSSPNFSQEEIGTPILTVTLEPGDLLYLPRGYIHQASTVTNEHSLHVTISVYQKTAWIDLLEKAMPKALQAAGATDLEFRRGLPIGYLRYAGLARGKPVDIQADRLAMKENLKDLLAKLVEYVDLDDGVDEMGKQLMHDALPPVLSPEELQCSVFENGLRMSQTGEVYNATQITKDTKVRLVRANA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DHWEKEPLYISRKQKNYYNNLITSKKIDDILRDNVIEFKKNIDITLYEDGQRQTMDVEGRALPQIVWDHYREGCSIRFLNPQTYIKPLQQLNASLQELFGCFVGANTYQTPPTAQGFAPHYDDIEAFILQLEGKKKWKVYLPRMVDEYLPRYSSPNFSQEEIGTPILTVTLEPGDLLYLPRGYIHQASTVTNEHSLHVTISVYQKTAWIDLLEKAMPKALQAAGATDLEFRRGLPIGYLRYAGLARGKPVDIQADRLAMKENLKDLLAKLVEYVDLDDGVDEMGKQLMHDALPPVLSPEELQCSVFENGLRMSQTGEVYNATQITKDTKVRLVRANAVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 Histone demethylase that specifically demethylates 'Lys-4' (H3K4me) and 'Lys-36' (H3K36me) of histone H3, thereby playing a central role in histone code. Preferentially demethylates trimethylated H3 'Lys-4' (H3K4me3) and monomethylated H3 'Lys-4' (H3K4me1) residues, while it has weaker activity for dimethylated H3 'Lys-36' (H3K36me2). Acts as a regulator of osteoblast differentiation via its interaction with sp7/osx by demethylating H3K4me and H3K36me, thereby inhibiting sp7/osx-mediated promoter activation. May also play a role in ribosome biogenesis and in the replication or remodeling of certain heterochromatic region.confidentA3KP59
Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 Histone demethylase that specifically demethylates 'Lys-4' (H3K4me) and 'Lys-36' (H3K36me) of histone H3, thereby playing a central role in histone code.confidentQ54K96

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003674 [MF]molecular_functionprobable
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DIQ, chain A
Confidence level:very confident
Coverage over the Query: 1-339
View the alignment between query and template
View the model in PyMOL