Diaphorina citri psyllid: psy13798


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610----
MSVNSPIRFHHDKWLWKLCGSVWTGSRFYTHIWFKSPLSTELYQTMRRVHDAVVSVAGSLQSTQPEVQYLKERHLQLRQTYLKDSTNVFDVERGGRDTKLPRDVEGPSPFSAGFSFGSTATQPAFGAGTTTSGQGFGGFGSATARLCNSIGSPAFGSTNTFGTPTTQQSTGFGGFGTSTHLVHLVLSRQLPLRLDFHLAPQQHSQHLWAGFSFGSTATQPAFGAGTTTSGQGFGGFGTGTATFGSTNTSTGGLFGSGGTTTAQPGFGSSAFGTPSAPTPAFGSPAFGSTNTFGTPTTQQSTGFGGFGTSTFGSQPTQQSGLSFNSPSTTQSGLTFGAPSGGLNFGTPTTQATSAFGTPTQSTGLSFGNFNSGLTFGAPSGGLNFGTPTTQATSAFGTPTQSTGLSFGPPFLFRSNETTATLDACVQSFGSTTPAQGFGSTAQTGLSFGTPSATQASGGFSFGGGTAPQTGGLNFGTPTSTQQPLFGAPATTAQTGFSFGTPAATSQPSVGFGAAATTQSVGFGAPATSQSVTFGAQPASQPSVGFGAPATTQTGLSFGAPATSQPALSFGSSATGQAAGFSFGSSAPASSQPSLSFGAAIWIFSNRSSSWVFIW
cccccccccccHHHHHHHHcccccccCEECcccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
****S*IRFHHDKWLWKLCGSVWTGSRFYTHIWFKSPLSTELYQTMRRVHDAVVSVAGSLQST*PEVQYLKERHLQLRQTYLKDST*****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************SSW*FIW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVNSPIRFHHDKWLWKLCGSVWTGSRFYTHIWFKSPLSTELYQTMRRVHDAVVSVAGSLQSTQPEVQYLKERHLQLRQTYLKDSTNVFDVERGGRDTKLPRDVEGPSPFSAGFSFGSTATQPAFGAGTTTSGQGFGGFGSATARLCNSIGSPAFGSTNTFGTPTTQQSTGFGGFGTSTHLVHLVLSRQLPLRLDFHLAPQQHSQHLWAGFSFGSTATQPAFGAGTTTSGQGFGGFGTGTATFGSTNTSTGGLFGSGGTTTAQPGFGSSAFGTPSAPTPAFGSPAFGSTNTFGTPTTQQSTGFGGFGTSTFGSQPTQQSGLSFNSPSTTQSGLTFGAPSGGLNFGTPTTQATSAFGTPTQSTGLSFGNFNSGLTFGAPSGGLNFGTPTTQATSAFGTPTQSTGLSFGPPFLFRSNETTATLDACVQSFGSTTPAQGFGSTAQTGLSFGTPSATQASGGFSFGGGTAPQTGGLNFGTPTSTQQPLFGAPATTAQTGFSFGTPAATSQPSVGFGAAATTQSVGFGAPATSQSVTFGAQPASQPSVGFGAPATTQTGLSFGAPATSQPALSFGSSATGQAAGFSFGSSAPASSQPSLSFGAAIWIFSNRSSSWVFIW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032991 [CC]macromolecular complexprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T98, chain B
Confidence level:confident
Coverage over the Query: 36-83
View the alignment between query and template
View the model in PyMOL
Template: 3MMY, chain B
Confidence level:probable
Coverage over the Query: 301-343
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1twf, chain Aprobable Alignment | Template Structure
3ghg, chain Aprobable Alignment | Template Structure
1twf, chain Aprobable Alignment | Template Structure