Diaphorina citri psyllid: psy13801


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MVLNISLLSMEASAVNMLCIMFWLCTDLYQITMAYAYWKSGKVTDNAVFDLFFRQNPFQGEFTIFAGLEECIRFLENFRYSDSVPNRE
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccccEEEEEcHHHHHHHHHcccccccccccc
***NISLLSMEASAVNMLCIMFWLCTDLYQITMAYAYWKSGKVTDNAVFDLFFRQNPFQGEFTIFAGLEECIRFLENFRY********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLNISLLSMEASAVNMLCIMFWLCTDLYQITMAYAYWKSGKVTDNAVFDLFFRQNPFQGEFTIFAGLEECIRFLENFRYSDSVPNRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nicotinate phosphoribosyltransferase Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.confidentQ6XQN1
Nicotinate phosphoribosyltransferase Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN).confidentQ55G10
Nicotinate phosphoribosyltransferase Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.confidentQ6XQN6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F7F, chain A
Confidence level:very confident
Coverage over the Query: 22-86
View the alignment between query and template
View the model in PyMOL