Diaphorina citri psyllid: psy13804


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MAKRIQMRKNRFMALQKVAEQKKTIEATGHPGQLGLGHGPPGGTLENTINGRSTDEEANAPPGPGGGAHLIHPGKDINKLYGITPSDIDKYSRIVFPVCFVCFNLMYWIIYLHISDVVADDLVLLEEDK
cHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHEEccccccccccccccc
*********************************************************************LIHPGKDINKLYGITPSDIDKYSRIVFPVCFVCFNLMYWIIYLHISDVVADDLVLLE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKRIQMRKNRFMALQKVAEQKKTIEATGHPGQLGLGHGPPGGTLENTINGRSTDEEANAPPGPGGGAHLIHPGKDINKLYGITPSDIDKYSRIVFPVCFVCFNLMYWIIYLHISDVVADDLVLLEEDK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gamma-aminobutyric acid receptor subunit beta GABA, an inhibitory neurotransmitter, mediates neuronal inhibition by binding to the GABA receptor and opening an integral chloride channel.confidentP25123

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0003674 [MF]molecular_functionprobable
GO:0042749 [BP]regulation of circadian sleep/wake cycleprobableGO:0050896, GO:0007623, GO:0007622, GO:0044708, GO:0042745, GO:0048583, GO:0048512, GO:0050795, GO:0048511, GO:0042752, GO:0065007, GO:0022410, GO:0051239, GO:0008150, GO:0007610, GO:0050789
GO:0050805 [BP]negative regulation of synaptic transmissionprobableGO:0044057, GO:0050794, GO:0031644, GO:0031645, GO:0051241, GO:0050804, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0051239, GO:0023051, GO:0048519, GO:0051969, GO:0010646, GO:0051970, GO:0050789, GO:0048523
GO:0090328 [BP]regulation of olfactory learningprobableGO:0044057, GO:0031644, GO:0048583, GO:0050795, GO:0065007, GO:0051239, GO:0008150, GO:0050789
GO:0009612 [BP]response to mechanical stimulusprobableGO:0009628, GO:0050896, GO:0008150, GO:0009605
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0030431 [BP]sleepprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RHW, chain A
Confidence level:confident
Coverage over the Query: 84-113
View the alignment between query and template
View the model in PyMOL