Diaphorina citri psyllid: psy13811

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------

MDRTDRYWVVMDRTVMDGMDEMRVVERRTVLDSMPDAWSERERMYVQFPGELFLKMLKCLIVPLLVSSIVSAIGSLDLSLSKRVGFRSIAYYCATTSIAVVEGIILVCTIRPGVGHASMKGAQAGNYSKTSLTTDTLMDLSRVLFYILCVTELYFILCVTELWQMRGEWVVGSNVLGLVFFSIAMGIAIARIGKAGKPLLSVFESLSEVVMTITTWVIWISPFGIFFLVAEKIIDMKSLSHTVGQLGLYFITVLLGLLIHGFILLPAMYTFFVREWPFRFTANMGQAIATAFGTASR

ccccccHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccc

*****RYWVVMDRTVMDGMDEMRVVERRTVLDSMPDAWSERERMYVQFPGELFLKMLKCLIVPLLVSSIVSAIGSLDLSLSKRVGFRSIAYYCATTSIAVVEGIILVCTIRPGVGH**************SLTTDTLMDLSRVLFYILCVTELYFILCVTELWQMRGEWVVGSNVLGLVFFSIAMGIAIARIGKAGKPLLSVFESLSEVVMTITTWVIWISPFGIFFLVAEKIIDMKSLSHTVGQLGLYFITVLLGLLIHGFILLPAMYTFFVREWPFRFTANMGQAIATAFGTAS*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003333 [BP]	amino acid transmembrane transport	probable	GO:0006810, GO:0006820, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0051179, GO:0071705, GO:0034220, GO:0044765, GO:0044763, GO:0071702, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699, GO:0046942
GO:0015175 [MF]	neutral amino acid transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015171, GO:0046943
GO:0008324 [MF]	cation transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674
GO:0044463 [CC]	cell projection part	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0051938 [BP]	L-glutamate import	probable	GO:0006810, GO:0043090, GO:0044765, GO:0043092, GO:0015813, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0015807, GO:0015800, GO:0008150, GO:0071702, GO:0006835, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0005313 [MF]	L-glutamate transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005310, GO:0008509, GO:0015075, GO:0015172, GO:0022857, GO:0003674, GO:0015179, GO:0005215, GO:0015171, GO:0046943
GO:0006812 [BP]	cation transport	probable	GO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0045202 [CC]	synapse	probable	GO:0005575
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0015804 [BP]	neutral amino acid transport	probable	GO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0070779 [BP]	D-aspartate import	probable	GO:0006835, GO:0015810, GO:0043090, GO:0044765, GO:0051234, GO:0015849, GO:0006811, GO:0006865, GO:0070777, GO:0015711, GO:0071705, GO:0006820, GO:0015800, GO:0008150, GO:0006810, GO:0071702, GO:0042940, GO:0015740, GO:0051179, GO:0044699, GO:0046942
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NWL, chain A
Confidence level:very confident
Coverage over the Query: 43-153,170-297
View the alignment between query and template
View the model in PyMOL

Template: 3V8G, chain A
Confidence level:probable
Coverage over the Query: 37-123,145-246
View the alignment between query and template
View the model in PyMOL