Diaphorina citri psyllid: psy13817


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLRPEISYIMSLLSLLKQTRVNRLIVPLTRTLAKDVAPFNDIETHTGQKFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINL
ccccccccccccccccccccHHHHHHHHHccccEECcccEEEEccccccccccEEEEEcccccccHHHHHHHHHHHHccccccccccCECcccccccccccccccccccccccccccccccccccHHHHHHHHHcccccCCcccEEEEccccccccccEEEEcc
**E*DDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLRPEISYIMSLLSLLKQTRVNRLIVPLTRTLAKDVAPFNDIETHTGQKFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLRPEISYIMSLLSLLKQTRVNRLIVPLTRTLAKDVAPFNDIETHTGQKFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentO75380
NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentP52503
NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ0MQH7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JVM, chain A
Confidence level:very confident
Coverage over the Query: 23-72
View the alignment between query and template
View the model in PyMOL
Template: 2JRR, chain A
Confidence level:very confident
Coverage over the Query: 133-164
View the alignment between query and template
View the model in PyMOL