Diaphorina citri psyllid: psy13818


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
VGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKLEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSLIEGTVTTKVLSTRKRTGNESCPQPQTSEHLAAIEIMKLKHIIILQNKIDLVKEGQANEQHEQIVKFVQ
cccccccccccccccccEEccccccccccEEEEEEEHHHHHHHHHccccccccccHHHHHHHHHHHHccEEEccccccccccccccccEEEEEECcccccCEEEEEEccCEEEEECccCCcccccEEEEEEEEccEEEEEccccHHHHHHHHHccccccccccccHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHHc
VGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKLEISYHLLKRLLGVRME********QKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSLIEGTVTTKVLSTRKRTGNESCPQPQTSEHLAAIEIMKLKHIIILQNKIDLVKEGQANEQHEQIVKFVQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKLEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSLIEGTVTTKVLSTRKRTGNESCPQPQTSEHLAAIEIMKLKHIIILQNKIDLVKEGQANEQHEQIVKFVQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 2 subunit 3 eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.confidentP81795
Eukaryotic translation initiation factor 2 subunit 3 eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.confidentQ5ZMS3
Eukaryotic translation initiation factor 2 subunit 3 eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.confidentQ2KHU8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0043614 [CC]multi-eIF complexprobableGO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044424, GO:0005622
GO:0003743 [MF]translation initiation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S0U, chain A
Confidence level:very confident
Coverage over the Query: 2-44,69-145
View the alignment between query and template
View the model in PyMOL
Template: 1S0U, chain A
Confidence level:very confident
Coverage over the Query: 114-207
View the alignment between query and template
View the model in PyMOL