Psyllid ID: psy13818
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 207 | ||||||
| 51965696 | 473 | translation initiation factor 2 gamma su | 0.560 | 0.245 | 0.771 | 1e-51 | |
| 156537626 | 473 | PREDICTED: eukaryotic translation initia | 0.560 | 0.245 | 0.771 | 5e-51 | |
| 340727719 | 1082 | PREDICTED: hypothetical protein LOC10065 | 0.560 | 0.107 | 0.757 | 9e-51 | |
| 51965692 | 473 | translation initiation factor 2 gamma su | 0.560 | 0.245 | 0.764 | 2e-50 | |
| 283837917 | 473 | suppressor of variegation 3-9 isoform 2 | 0.560 | 0.245 | 0.757 | 3e-50 | |
| 383859816 | 1055 | PREDICTED: uncharacterized protein LOC10 | 0.560 | 0.109 | 0.75 | 3e-50 | |
| 170070385 | 418 | conserved hypothetical protein [Culex qu | 0.560 | 0.277 | 0.75 | 4e-50 | |
| 51965700 | 458 | translation initiation factor 2 gamma su | 0.560 | 0.253 | 0.764 | 6e-50 | |
| 51965694 | 475 | translation initiation factor 2 gamma su | 0.560 | 0.244 | 0.764 | 1e-49 | |
| 9409732 | 473 | eukaryotic translation initiation factor | 0.560 | 0.245 | 0.735 | 4e-49 |
| >gi|51965696|emb|CAG29670.1| translation initiation factor 2 gamma subunit [Forficula auricularia] | Back alignment and taxonomy information |
|---|
Score = 208 bits (529), Expect = 1e-51, Method: Compositional matrix adjust.
Identities = 108/140 (77%), Positives = 115/140 (82%), Gaps = 24/140 (17%)
Query: 1 VGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKLEIS 60
VGTKIEPTLCRADRLVGQVLGAVGALP+++IELE+SY+
Sbjct: 338 VGTKIEPTLCRADRLVGQVLGAVGALPEMYIELEVSYY---------------------- 375
Query: 61 YHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVC 120
LLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVC
Sbjct: 376 --LLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVC 433
Query: 121 TEVNEKIALSRRVEKHWSLI 140
TE++EKIALSRRVEKHW LI
Sbjct: 434 TEIDEKIALSRRVEKHWRLI 453
|
Source: Forficula auricularia Species: Forficula auricularia Genus: Forficula Family: Forficulidae Order: Dermaptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|156537626|ref|XP_001607783.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3, Y-linked-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|340727719|ref|XP_003402185.1| PREDICTED: hypothetical protein LOC100651661 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|51965692|emb|CAG29668.1| translation initiation factor 2 gamma subunit [Lepismachilis sp. VK-2004] | Back alignment and taxonomy information |
|---|
| >gi|283837917|ref|NP_001164640.1| suppressor of variegation 3-9 isoform 2 [Apis mellifera] gi|350412047|ref|XP_003489527.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3, Y-linked-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383859816|ref|XP_003705388.1| PREDICTED: uncharacterized protein LOC100876321 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|170070385|ref|XP_001869561.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167866297|gb|EDS29680.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|51965700|emb|CAG29672.1| translation initiation factor 2 gamma subunit [Locusta migratoria] | Back alignment and taxonomy information |
|---|
| >gi|51965694|emb|CAG29669.1| translation initiation factor 2 gamma subunit [Enallagma cyathigerum] | Back alignment and taxonomy information |
|---|
| >gi|9409732|emb|CAB98197.1| eukaryotic translation initiation factor 2 gamma [Clytus arietis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 207 | ||||||
| ZFIN|ZDB-GENE-030131-5552 | 472 | eif2s3 "eukaryotic translation | 0.579 | 0.254 | 0.658 | 1.4e-32 | |
| UNIPROTKB|Q2VIR3 | 472 | EIF2S3L "Putative eukaryotic t | 0.579 | 0.254 | 0.65 | 2.9e-32 | |
| UNIPROTKB|F1NPF0 | 472 | EIF2S3 "Eukaryotic translation | 0.579 | 0.254 | 0.65 | 3.7e-32 | |
| UNIPROTKB|Q5ZMS3 | 472 | EIF2S3 "Eukaryotic translation | 0.579 | 0.254 | 0.65 | 3.7e-32 | |
| UNIPROTKB|G3N0A9 | 473 | EIF2S3Y "Uncharacterized prote | 0.579 | 0.253 | 0.65 | 3.7e-32 | |
| UNIPROTKB|Q2KHU8 | 472 | EIF2S3 "Eukaryotic translation | 0.579 | 0.254 | 0.65 | 3.7e-32 | |
| UNIPROTKB|E2RMK6 | 472 | EIF2S3 "Uncharacterized protei | 0.579 | 0.254 | 0.65 | 3.7e-32 | |
| UNIPROTKB|P41091 | 472 | EIF2S3 "Eukaryotic translation | 0.579 | 0.254 | 0.65 | 3.7e-32 | |
| UNIPROTKB|F1SPY4 | 472 | EIF2S3 "Eukaryotic translation | 0.579 | 0.254 | 0.65 | 3.7e-32 | |
| UNIPROTKB|Q2VIR0 | 471 | Q2VIR0 "EFI-2-gamma" [Pongo py | 0.579 | 0.254 | 0.65 | 3.7e-32 |
| ZFIN|ZDB-GENE-030131-5552 eif2s3 "eukaryotic translation initiation factor 2, subunit 3 gamma" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 356 (130.4 bits), Expect = 1.4e-32, P = 1.4e-32
Identities = 79/120 (65%), Positives = 91/120 (75%)
Query: 21 GAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKLEISYHLLKRLLGVRMEGDKKGAK 80
G +G KI L + ++ ++LG + +LEISY LL+RLLGVR EGDKK AK
Sbjct: 335 GLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAK 394
Query: 81 VQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSLI 140
VQKL++NEVL+VNIGSLSTGGRV A KADLAKI LTNPVCTEV EKIALSRRVEKHW LI
Sbjct: 395 VQKLSKNEVLMVNIGSLSTGGRVSAVKADLAKIVLTNPVCTEVGEKIALSRRVEKHWRLI 454
|
|
| UNIPROTKB|Q2VIR3 EIF2S3L "Putative eukaryotic translation initiation factor 2 subunit 3-like protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NPF0 EIF2S3 "Eukaryotic translation initiation factor 2 subunit 3" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZMS3 EIF2S3 "Eukaryotic translation initiation factor 2 subunit 3" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N0A9 EIF2S3Y "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2KHU8 EIF2S3 "Eukaryotic translation initiation factor 2 subunit 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RMK6 EIF2S3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P41091 EIF2S3 "Eukaryotic translation initiation factor 2 subunit 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SPY4 EIF2S3 "Eukaryotic translation initiation factor 2 subunit 3" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2VIR0 Q2VIR0 "EFI-2-gamma" [Pongo pygmaeus (taxid:9600)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 207 | |||
| PTZ00327 | 460 | PTZ00327, PTZ00327, eukaryotic translation initiat | 2e-51 | |
| COG5257 | 415 | COG5257, GCD11, Translation initiation factor 2, g | 4e-38 | |
| pfam09173 | 88 | pfam09173, eIF2_C, Initiation factor eIF2 gamma, C | 8e-36 | |
| cd01888 | 197 | cd01888, eIF2_gamma, Gamma subunit of initiation f | 3e-29 | |
| PTZ00327 | 460 | PTZ00327, PTZ00327, eukaryotic translation initiat | 3e-28 | |
| PRK04000 | 411 | PRK04000, PRK04000, translation initiation factor | 6e-26 | |
| TIGR03680 | 406 | TIGR03680, eif2g_arch, translation initiation fact | 1e-23 | |
| COG5257 | 415 | COG5257, GCD11, Translation initiation factor 2, g | 8e-23 | |
| PRK04000 | 411 | PRK04000, PRK04000, translation initiation factor | 4e-19 | |
| TIGR03680 | 406 | TIGR03680, eif2g_arch, translation initiation fact | 1e-17 | |
| cd03688 | 113 | cd03688, eIF2_gamma_II, eIF2_gamma_II: this subfam | 9e-09 | |
| cd04171 | 170 | cd04171, SelB, SelB, the dedicated elongation fact | 1e-06 | |
| pfam00009 | 184 | pfam00009, GTP_EFTU, Elongation factor Tu GTP bind | 1e-05 | |
| COG3276 | 447 | COG3276, SelB, Selenocysteine-specific translation | 0.002 | |
| TIGR00475 | 581 | TIGR00475, selB, selenocysteine-specific elongatio | 0.002 |
| >gnl|CDD|240362 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
Score = 171 bits (436), Expect = 2e-51
Identities = 74/141 (52%), Positives = 91/141 (64%), Gaps = 25/141 (17%)
Query: 1 VGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKLEIS 60
VGT I+PTL RADRLVGQVLG G LP+++ E +EI
Sbjct: 328 VGTTIDPTLTRADRLVGQVLGYPGKLPEVYAE------------------------IEIQ 363
Query: 61 YHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKAD-LAKISLTNPV 119
Y+LL+RLLGV+ + KK KV KL + E L++NIGS +TGGRV+ K D +AK+ LT PV
Sbjct: 364 YYLLRRLLGVKSQDGKKATKVAKLKKGESLMINIGSTTTGGRVVGIKDDGIAKLELTTPV 423
Query: 120 CTEVNEKIALSRRVEKHWSLI 140
CT V EKIALSRRV+KHW LI
Sbjct: 424 CTSVGEKIALSRRVDKHWRLI 444
|
Length = 460 |
| >gnl|CDD|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|150009 pfam09173, eIF2_C, Initiation factor eIF2 gamma, C terminal | Back alignment and domain information |
|---|
| >gnl|CDD|206675 cd01888, eIF2_gamma, Gamma subunit of initiation factor 2 (eIF2 gamma) | Back alignment and domain information |
|---|
| >gnl|CDD|240362 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >gnl|CDD|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >gnl|CDD|239659 cd03688, eIF2_gamma_II, eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea | Back alignment and domain information |
|---|
| >gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome | Back alignment and domain information |
|---|
| >gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| KOG0466|consensus | 466 | 100.0 | ||
| COG5257 | 415 | GCD11 Translation initiation factor 2, gamma subun | 100.0 | |
| PF09173 | 88 | eIF2_C: Initiation factor eIF2 gamma, C terminal; | 99.97 | |
| COG5257 | 415 | GCD11 Translation initiation factor 2, gamma subun | 99.92 | |
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 99.79 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 99.77 | |
| KOG0460|consensus | 449 | 99.76 | ||
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 99.75 | |
| COG3276 | 447 | SelB Selenocysteine-specific translation elongatio | 99.73 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 99.66 | |
| KOG0466|consensus | 466 | 99.63 | ||
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 99.62 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 99.61 | |
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 99.54 | |
| KOG0458|consensus | 603 | 99.53 | ||
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 99.47 | |
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 99.46 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 99.42 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 99.39 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 99.38 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 99.38 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 99.32 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 99.29 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 99.28 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 99.25 | |
| CHL00071 | 409 | tufA elongation factor Tu | 99.2 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 99.2 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 99.16 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 99.16 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 99.14 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 99.11 | |
| KOG0459|consensus | 501 | 99.1 | ||
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 99.09 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 99.08 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 99.07 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 99.06 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 98.98 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 98.97 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 98.78 | |
| cd04094 | 97 | selB_III This family represents the domain of elon | 98.58 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 98.58 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 98.56 | |
| COG5258 | 527 | GTPBP1 GTPase [General function prediction only] | 98.53 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 98.49 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 98.43 | |
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 98.39 | |
| KOG0461|consensus | 522 | 98.35 | ||
| KOG0052|consensus | 391 | 98.34 | ||
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 98.3 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 98.28 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 98.23 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 98.22 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 98.21 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 98.21 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 98.1 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 98.07 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 98.06 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 98.03 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 98.01 | |
| KOG0462|consensus | 650 | 97.95 | ||
| KOG1143|consensus | 591 | 97.88 | ||
| PTZ00416 | 836 | elongation factor 2; Provisional | 97.87 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 97.81 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 97.78 | |
| KOG1145|consensus | 683 | 97.76 | ||
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 97.68 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 97.66 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 97.66 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 97.63 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 97.57 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 97.57 | |
| KOG0463|consensus | 641 | 97.56 | ||
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 97.55 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 97.51 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 97.47 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 97.38 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 97.36 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 97.33 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 97.3 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 97.27 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 97.12 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 97.11 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 97.05 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 96.99 | |
| cd03707 | 90 | EFTU_III Domain III of elongation factor (EF) Tu. | 96.91 | |
| cd03706 | 93 | mtEFTU_III Domain III of mitochondrial EF-TU (mtEF | 96.78 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 96.78 | |
| CHL00071 | 409 | tufA elongation factor Tu | 96.69 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 96.53 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 96.27 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 96.17 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 95.97 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 95.81 | |
| cd01513 | 102 | Translation_factor_III Domain III of Elongation fa | 95.76 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 95.67 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 95.64 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 95.63 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 95.51 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 95.44 | |
| cd03708 | 87 | GTPBP_III Domain III of the GP-1 family of GTPase. | 95.28 | |
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 95.02 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 94.97 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 94.86 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 94.82 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 94.7 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 94.48 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 94.19 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 94.03 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 93.81 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 93.73 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 93.71 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 93.56 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 93.36 | |
| COG2229 | 187 | Predicted GTPase [General function prediction only | 93.26 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 93.14 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 93.03 | |
| KOG1144|consensus | 1064 | 92.98 | ||
| PRK00049 | 396 | elongation factor Tu; Reviewed | 92.95 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 92.85 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 92.81 | |
| KOG0465|consensus | 721 | 92.78 | ||
| PRK12735 | 396 | elongation factor Tu; Reviewed | 92.63 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 92.54 | |
| KOG0467|consensus | 887 | 92.52 | ||
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 92.5 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 92.46 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 92.37 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 92.06 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 91.4 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 91.3 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 91.26 | |
| KOG0464|consensus | 753 | 91.09 | ||
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 91.05 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 90.78 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 90.61 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 90.15 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 89.74 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 89.66 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 89.62 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 89.43 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 88.43 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 88.09 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 87.68 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 87.61 | |
| KOG0468|consensus | 971 | 87.33 | ||
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 87.1 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 87.0 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 86.43 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 84.74 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 84.46 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 83.69 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 82.79 | |
| PRK13768 | 253 | GTPase; Provisional | 82.71 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 82.34 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 82.22 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 82.0 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 81.95 | |
| cd01850 | 276 | CDC_Septin CDC/Septin. Septins are a conserved fam | 81.36 |
| >KOG0466|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.2e-45 Score=332.50 Aligned_cols=118 Identities=78% Similarity=1.173 Sum_probs=116.6
Q ss_pred CCCccCCccccccccceeeccCCCCCCcceEEEEEeHhhHHHHHhhhccCCcccccccceeeeeeecccccccCCcccce
Q psy13818 1 VGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKLEISYHLLKRLLGVRMEGDKKGAK 80 (207)
Q Consensus 1 vgt~~dp~l~~~d~lvG~v~g~~g~lp~v~~~l~i~~~Ll~r~~~~~~~~~~~~~~~~~~~~~~~~~~Gv~t~~~k~~~K 80 (207)
|||++||||||||||||||+|+.|+||++|.||||+||||+|++ |++|+++++++|
T Consensus 336 VGT~~DPtlcraDrlVGqVlG~~G~LP~if~elei~y~Llrrll------------------------gvrt~~~~k~~k 391 (466)
T KOG0466|consen 336 VGTKMDPTLCRADRLVGQVLGAVGTLPDIFTELEISYFLLRRLL------------------------GVRTKGDKKQAK 391 (466)
T ss_pred eccccCcchhhhhHHHHHHHhhccCCccceeEEEeehhhhhHHh------------------------ccccccccccch
Confidence 79999999999999999999999999999999999999999999 899999999999
Q ss_pred eccCccCceEEEEeeccccceEEEEEecceEEEEeeCcccccCCcEEEEEEeecCcceeecc
Q psy13818 81 VQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSLIEG 142 (207)
Q Consensus 81 v~~l~~~E~lmlniGs~~t~g~V~~~~~Dla~i~L~~Pvc~~~G~kiaIsR~V~gh~rligg 142 (207)
|++|.+||+||+||||+||||+|.++|+|++++.|+.|+|++.|+|+|+|||+..|||||||
T Consensus 392 v~kL~k~E~lmvNIGS~sTG~~v~~vk~d~~k~~Lt~P~CteigEkiAlSRrvekhWRLIGw 453 (466)
T KOG0466|consen 392 VSKLVKNEILMVNIGSTSTGGRVSAVKADMAKIQLTSPVCTEIGEKIALSRRVEKHWRLIGW 453 (466)
T ss_pred hhhcccCcEEEEEecccccCceEEEEecceeeeEecCchhcccchhhhhhhhhhhheEEecc
Confidence 99999999999999999999999999999999999999999999999999999999999995
|
|
| >COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF09173 eIF2_C: Initiation factor eIF2 gamma, C terminal; InterPro: IPR015256 This entry represents a domain which is found in the initiation factors eIF2 and EF-Tu, adopting a beta barrel structure with Greek key topology | Back alignment and domain information |
|---|
| >COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0460|consensus | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0466|consensus | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >KOG0458|consensus | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >KOG0459|consensus | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >cd04094 selB_III This family represents the domain of elongation factor SelB, homologous to domain III of EF-Tu | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >COG5258 GTPBP1 GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0461|consensus | Back alignment and domain information |
|---|
| >KOG0052|consensus | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >KOG0462|consensus | Back alignment and domain information |
|---|
| >KOG1143|consensus | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >KOG1145|consensus | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >KOG0463|consensus | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >cd03707 EFTU_III Domain III of elongation factor (EF) Tu | Back alignment and domain information |
|---|
| >cd03706 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF-TU) | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >cd01513 Translation_factor_III Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >cd03708 GTPBP_III Domain III of the GP-1 family of GTPase | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >COG2229 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >KOG1144|consensus | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >KOG0465|consensus | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >KOG0467|consensus | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >KOG0464|consensus | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >KOG0468|consensus | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >cd01850 CDC_Septin CDC/Septin | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 207 | ||||
| 1s0u_A | 408 | Eif2gamma Apo Length = 408 | 2e-16 | ||
| 1s0u_A | 408 | Eif2gamma Apo Length = 408 | 1e-13 | ||
| 2d74_A | 419 | Crystal Structure Of Translation Initiation Factor | 2e-15 | ||
| 2d74_A | 419 | Crystal Structure Of Translation Initiation Factor | 2e-10 | ||
| 1kk3_A | 410 | Structure Of The Wild-Type Large Gamma Subunit Of I | 5e-15 | ||
| 1kk3_A | 410 | Structure Of The Wild-Type Large Gamma Subunit Of I | 9e-11 | ||
| 1kjz_A | 410 | Structure Of The Large Gamma Subunit Of Initiation | 5e-15 | ||
| 1kjz_A | 410 | Structure Of The Large Gamma Subunit Of Initiation | 1e-10 | ||
| 1kk0_A | 410 | Structure Of The Large Gamma Subunit Of Initiation | 1e-14 | ||
| 1kk0_A | 410 | Structure Of The Large Gamma Subunit Of Initiation | 1e-10 | ||
| 3pen_A | 403 | Structure Of Archaeal Initiation Factor Aif2gamma S | 2e-08 | ||
| 2aho_A | 414 | Structure Of The Archaeal Initiation Factor Eif2 Al | 2e-08 | ||
| 2pmd_A | 415 | The Structures Of Aif2gamma Subunit From The Archae | 2e-08 | ||
| 3sjz_A | 409 | The Structure Of Aif2gamma Subunit Delta 41-45 From | 2e-08 |
| >pdb|1S0U|A Chain A, Eif2gamma Apo Length = 408 | Back alignment and structure |
|
| >pdb|1S0U|A Chain A, Eif2gamma Apo Length = 408 | Back alignment and structure |
| >pdb|2D74|A Chain A, Crystal Structure Of Translation Initiation Factor Aif2betagamma Heterodimer Length = 419 | Back alignment and structure |
| >pdb|2D74|A Chain A, Crystal Structure Of Translation Initiation Factor Aif2betagamma Heterodimer Length = 419 | Back alignment and structure |
| >pdb|1KK3|A Chain A, Structure Of The Wild-Type Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Complexed With Gdp-Mg2+ Length = 410 | Back alignment and structure |
| >pdb|1KK3|A Chain A, Structure Of The Wild-Type Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Complexed With Gdp-Mg2+ Length = 410 | Back alignment and structure |
| >pdb|1KJZ|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi-G235d Mutant Length = 410 | Back alignment and structure |
| >pdb|1KJZ|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi-G235d Mutant Length = 410 | Back alignment and structure |
| >pdb|1KK0|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Length = 410 | Back alignment and structure |
| >pdb|1KK0|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Length = 410 | Back alignment and structure |
| >pdb|3PEN|A Chain A, Structure Of Archaeal Initiation Factor Aif2gamma Subunit Delta 37-47 From Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 403 | Back alignment and structure |
| >pdb|2AHO|A Chain A, Structure Of The Archaeal Initiation Factor Eif2 Alpha- Gamma Heterodimer From Sulfolobus Solfataricus Complexed With Gdpnp Length = 414 | Back alignment and structure |
| >pdb|2PMD|A Chain A, The Structures Of Aif2gamma Subunit From The Archaeon Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 415 | Back alignment and structure |
| >pdb|3SJZ|A Chain A, The Structure Of Aif2gamma Subunit Delta 41-45 From Archaeon Sulfolobus Solfataricus Complexed With Gdp And Gdpnp Length = 409 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 207 | |||
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 4e-40 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 7e-24 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 3e-39 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 2e-23 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 2e-38 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 1e-23 |
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 | Back alignment and structure |
|---|
Score = 140 bits (354), Expect = 4e-40
Identities = 44/146 (30%), Positives = 70/146 (47%), Gaps = 30/146 (20%)
Query: 1 VGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKLEIS 60
VGTK++P L + D + G V+G G LP ++ L + HLL+R++G
Sbjct: 293 VGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVGTE------------- 339
Query: 61 YHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVC 120
+ KV+ + R EVLL+N+G+ T G V D ++ L PVC
Sbjct: 340 ----------------QELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVC 383
Query: 121 TEVNEKIALSRRVEKHWSLI-EGTVT 145
E +++A+SR++ W LI G +
Sbjct: 384 AEPGDRVAISRQIGSRWRLIGYGIIK 409
|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 99.73 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 99.64 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 99.62 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 99.51 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 99.47 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 99.28 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 99.28 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 99.21 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 99.18 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 99.17 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 99.14 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 99.11 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 99.07 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 99.07 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 99.05 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 99.01 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 99.0 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 98.87 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 98.85 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 98.66 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 98.53 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 98.5 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 98.27 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 98.21 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 98.08 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 98.07 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 98.04 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 98.04 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 97.76 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 97.7 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 97.63 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 97.47 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 97.39 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 97.31 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 97.25 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 97.23 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 97.2 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 97.09 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 96.8 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 96.73 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 96.61 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 96.37 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 95.75 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 95.72 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 95.69 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 95.28 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 95.24 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 94.98 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 94.79 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 94.38 | |
| 3e1y_E | 204 | Eukaryotic peptide chain release factor GTP-bindi | 93.48 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 93.3 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 93.1 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 92.65 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 92.57 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 92.36 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 92.29 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 91.91 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 91.86 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 91.79 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 91.79 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 91.62 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 91.62 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 91.5 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 91.45 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 91.34 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 91.18 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 91.05 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 91.01 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 90.73 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 90.67 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 90.67 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 90.59 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 90.57 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 90.47 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 90.43 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 90.42 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 90.37 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 89.95 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 89.34 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 88.84 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 88.7 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 88.31 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 88.08 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 87.88 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 87.8 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 87.69 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 87.67 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 87.63 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 87.62 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 87.43 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 87.16 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 86.97 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 86.55 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 86.46 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 86.11 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 85.93 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 85.85 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 85.81 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 85.47 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 85.46 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 85.44 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 84.97 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 84.63 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 84.62 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 84.61 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 84.53 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 84.48 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 84.29 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 84.18 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 84.17 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 84.13 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 83.94 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 83.78 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 83.76 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 83.71 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 83.59 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 83.52 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 83.28 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 83.12 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 82.92 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 82.67 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 82.44 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 82.04 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 81.56 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 81.33 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 81.27 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 81.2 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 81.01 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 80.98 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 80.95 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 80.92 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 80.91 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 80.36 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 80.32 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 80.09 |
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
Probab=99.73 E-value=2.1e-18 Score=154.43 Aligned_cols=114 Identities=32% Similarity=0.587 Sum_probs=105.2
Q ss_pred CCccCCccccccccceeeccCCCCCCcceEEEEEeHhhHHHHHhhhccCCcccccccceeeeeeecccccccCCccccee
Q psy13818 2 GTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKLEISYHLLKRLLGVRMEGDKKGAKV 81 (207)
Q Consensus 2 gt~~dp~l~~~d~lvG~v~g~~g~lp~v~~~l~i~~~Ll~r~~~~~~~~~~~~~~~~~~~~~~~~~~Gv~t~~~k~~~Kv 81 (207)
++++||.++|.|-+.|+|++.|+++|+++.+++.++++|.+.. |.+ ++.+.
T Consensus 286 ~l~~~~~~~~~d~~~G~vl~~~~~~~~~~~~~~a~~~~l~~~~------------------------~~~-----~~~~~ 336 (403)
T 3sjy_A 286 GTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVV------------------------GAK-----EMLKV 336 (403)
T ss_dssp EESSCHHHHGGGTTTTCEEEETTCCCCEEEEEEEEEEECSBCT------------------------TCS-----SCCBC
T ss_pred EeccccccchhhhccccEEeCCCCCCcceeEEEEEEEEEeccc------------------------ccc-----ccccC
Confidence 3568999999999999999999999999999999999998887 442 24568
Q ss_pred ccCccCceEEEEeeccccceEEEEEecceEEEEeeCcccccCCc-EEEEEEeecCcceeec-ccc
Q psy13818 82 QKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNE-KIALSRRVEKHWSLIE-GTV 144 (207)
Q Consensus 82 ~~l~~~E~lmlniGs~~t~g~V~~~~~Dla~i~L~~Pvc~~~G~-kiaIsR~V~gh~rlig-g~~ 144 (207)
+||+.|+.+++.+||..+.|+|..+++|.+++.|..|+|++.|+ |++|||++.+|||+|| |.|
T Consensus 337 ~~l~~~~~~~~~~gt~~~~~~v~~~~~~~~~~~l~~p~~~~~g~~r~~i~r~~~~~~r~~g~g~i 401 (403)
T 3sjy_A 337 DPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLV 401 (403)
T ss_dssp CCCCTTCEEEEEETTEEEEEEEEEECSSEEEEEEEEEEECCSSSCEEEEEEEETTEEEEEEEEEE
T ss_pred CCCCCCCEEEEEECccEEEEEEEEecCceEEEEeCCcEeeccCCEEEEEEEEeCCcEEEEEEEEE
Confidence 89999999999999999999999999999999999999999999 9999999999999999 544
|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 207 | ||||
| d1kk1a2 | 89 | b.44.1.1 (A:322-410) Initiation factor eIF2 gamma | 2e-32 | |
| d1s0ua2 | 90 | b.44.1.1 (A:348-437) Initiation factor eIF2 gamma | 2e-32 | |
| d2qn6a2 | 95 | b.44.1.1 (A:321-415) Initiation factor eIF2 gamma | 1e-30 | |
| d1kk1a1 | 121 | b.43.3.1 (A:201-321) Initiation factor eIF2 gamma | 3e-05 | |
| d1s0ua1 | 118 | b.43.3.1 (A:230-347) Initiation factor eIF2 gamma | 1e-04 | |
| d2c78a3 | 204 | c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N | 5e-04 | |
| d1d2ea3 | 196 | c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), | 0.002 | |
| d1r5ba3 | 245 | c.37.1.8 (A:215-459) Eukaryotic peptide chain rele | 0.003 |
| >d1kk1a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 89 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Elongation factor/aminomethyltransferase common domain superfamily: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain family: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain domain: Initiation factor eIF2 gamma subunit species: Archaeon Pyrococcus abyssi [TaxId: 29292]
Score = 110 bits (277), Expect = 2e-32
Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 5/85 (5%)
Query: 56 KLEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISL 115
L + HLL+R++G ++ KV+ + R EVLL+N+G+ T G V D ++ L
Sbjct: 3 SLRLEVHLLERVVGT-----EQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKL 57
Query: 116 TNPVCTEVNEKIALSRRVEKHWSLI 140
PVC E +++A+SR++ W LI
Sbjct: 58 QIPVCAEPGDRVAISRQIGSRWRLI 82
|
| >d1s0ua2 b.44.1.1 (A:348-437) Initiation factor eIF2 gamma subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 90 | Back information, alignment and structure |
|---|
| >d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]} Length = 95 | Back information, alignment and structure |
|---|
| >d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 121 | Back information, alignment and structure |
|---|
| >d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 118 | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| d2qn6a2 | 95 | Initiation factor eIF2 gamma subunit {Sulfolobus s | 100.0 | |
| d1s0ua2 | 90 | Initiation factor eIF2 gamma subunit {Archaeon Met | 99.97 | |
| d1kk1a2 | 89 | Initiation factor eIF2 gamma subunit {Archaeon Pyr | 99.97 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 99.65 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 99.64 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 99.62 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 99.62 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 99.61 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 99.55 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 99.55 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 99.47 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 98.88 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 98.72 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 98.71 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 98.6 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 98.14 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 97.65 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 96.99 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 96.43 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 95.79 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 95.57 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 95.46 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 93.2 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 91.13 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 90.41 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 88.51 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 88.12 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 87.5 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 86.81 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 85.3 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 83.44 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 83.06 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 82.55 |
| >d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Elongation factor/aminomethyltransferase common domain superfamily: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain family: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain domain: Initiation factor eIF2 gamma subunit species: Sulfolobus solfataricus [TaxId: 2287]
Probab=100.00 E-value=2e-35 Score=224.77 Aligned_cols=91 Identities=32% Similarity=0.599 Sum_probs=80.6
Q ss_pred CCCCcceEEEEEeHhhHHHHHhhhccCCcccccccceeeeeeecccccccCCcccceeccCccCceEEEEeeccccceEE
Q psy13818 24 GALPKIFIELEISYHLLKRLLGVRMEGDKKGAKLEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRV 103 (207)
Q Consensus 24 g~lp~v~~~l~i~~~Ll~r~~~~~~~~~~~~~~~~~~~~~~~~~~Gv~t~~~k~~~Kv~~l~~~E~lmlniGs~~t~g~V 103 (207)
|.||++| +++|+||||+|++ |+ +++.||+||+.||+||+||||++|+|+|
T Consensus 1 g~LP~~~-~i~i~~~Ll~r~v------------------------G~-----~~~~kV~pi~~~E~LmlniGtatt~G~V 50 (95)
T d2qn6a2 1 AEVPVLW-NIRIKYNLLERVV------------------------GA-----KEMLKVDPIRAKETLMLSVGSSTTLGIV 50 (95)
T ss_dssp CCCCEEE-EEEEEEEECSSCC------------------------------------CCCCCTTCEEEEEETTEEEEEEE
T ss_pred CCCCcEE-EEEEEEEehHhhh------------------------CC-----CccccccCCcCCCEEEEEeccccccEEE
Confidence 7899887 7999999999999 77 5677999999999999999999999999
Q ss_pred EEEecceEEEEeeCcccccCCc-EEEEEEeecCcceeec-ccc
Q psy13818 104 LATKADLAKISLTNPVCTEVNE-KIALSRRVEKHWSLIE-GTV 144 (207)
Q Consensus 104 ~~~~~Dla~i~L~~Pvc~~~G~-kiaIsR~V~gh~rlig-g~~ 144 (207)
+++++|.+++.|+.|+||+.|+ |++||||+.+|||||| |++
T Consensus 51 ~~vk~d~~~v~L~~Pvca~~g~~rVaiSRri~~rWRLIG~G~I 93 (95)
T d2qn6a2 51 TSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLV 93 (95)
T ss_dssp EEECSSEEEEEEEEEEECSSSSEEEEEEEEETTEEEEEEEEEE
T ss_pred EEEeCCEEEEEecCCEEecCCCcEEEEEEEeCCEEEEEeEEEE
Confidence 9999999999999999999997 9999999999999999 654
|
| >d1s0ua2 b.44.1.1 (A:348-437) Initiation factor eIF2 gamma subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1kk1a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|