Diaphorina citri psyllid: psy13820

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------

MRQCWAEPPDMRPDFNEVNDLFKTLNQGRGRGHLLLLSLRYKNPHLGLRLKSLLYIDSPRKVNFVDTMFQMLEKYSNNLEDLIRERTEQLDIEKKKTEQLLNRMLPRKVNFVDTMFQMLEKYSNNLEDLIRERTEQLDIEKKKTEQLLNRMLPSSVAEKLKLGMPVDPEDFREVTIYFSDIVGFTTISAYSTPFEVVDLLNDLYTCFDATINAYNVYKVETIGDAYMVVGGLPVRIPDHADQIATMALDLLHHSGRFKIRHLPYTPLRLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRLESTGAPWRIHLSADTKAKLDQVGDYQLEYRGETELKGKGKMPTYWLLGKKGFYKELPTPPPLGDSHGLDENLILYGRTGPSTTIDLSPTEARSNHSSRSLQTSPGPGRTSQEHAVQLHRSPRNNGKSQTQKTSQNKILSQILSLDSTMEDATRLSAHKKYKYMKQNTFDSCFYIDMRDGYSLET

ccccccccccccccccccHHHHHHHccccccccHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccEEEEcccccHHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEcccccEEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEccccccccccccccccccccccccHHHHHHHHccccccccEEEcHHHHHHHHHcccEEEEECccEEEEcccEEEEEEEEccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccHHHHHHHccccHHHHHcccccccccccccccccccccc

*RQCWAEPPDMR*****VNDLFKTLNQGRGRGHLLLLSLRYKNPHLGLRLKSLLYIDSPRKVNFVDTMFQMLEKYSNNLEDLIRERTEQLDIEKKKTEQLLNRMLPRKVNFVDTMFQMLEKYSNNLEDLIRERTEQLDIEKKKTEQLLNRMLPSSVAEKLKLGMPVDPEDFREVTIYFSDIVGFTTISAYSTPFEVVDLLNDLYTCFDATINAYNVYKVETIGDAYMVVGGLPVRIPDHADQIATMALDLLHHSGRFKIRHLPYTPLRLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRLESTGAPWRIHLSADTKAKLDQVGDYQLEYRGETELKGKGKMPTYWLLGKKGFY*******************************************************************************************************HKKYKYMKQNTFDSCFYIDMRD******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRQCWAEPPDMRPDFNEVNDLFKTLNQGRGRGHLLLLSLRYKNPHLGLRLKSLLYIDSPRKVNFxxxxxxxxxxxxxxxxxxxxxxxxxxxxEKKKTEQLLNRMLPRKVNFxxxxxxxxxxxxxxxxxxxxxxxxxxxxEKKKTEQLLNRMLPSSVAEKLKLGMPVDPEDFREVTIYFSDIVGFTTISAYSTPFEVVDLLNDLYTCFDATINAYNVYKVETIGDAYMVVGGLPVRIPDHADQIATMALDLLHHSGRFKIRHLPYTPLRLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRLESTGAPWRIHLSADTKAKLDQVGDYQLEYRGETELKGKGKMPTYWLLGKKGFYKELPTPPPLGDSHGLDENLILYGRTGPSTTIDLSPTEARSNHSSRSLQTSPGPGRTSQEHAVQLHRSPRNNGKSQTQKTSQNKILSQILSLDSTMEDATRLSAHKKYKYMKQNTFDSCFYIDMRDGYSLET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Retinal guanylyl cyclase 2	Probably plays a specific functional role in the rods and/or cones of photoreceptors. It may be the enzyme involved in the resynthesis of cGMP required for recovery of the dark state after phototransduction.	confident	P51841
Retinal guanylyl cyclase 2	Probably plays a specific functional role in the rods and/or cones of photoreceptors. It may be the enzyme involved in the resynthesis of cGMP required for recovery of the dark state after phototransduction.	confident	O02740
Retinal guanylyl cyclase 2	Probably plays a specific functional role in the rods and/or cones of photoreceptors. It may be the enzyme involved in the resynthesis of cGMP required for recovery of the dark state after phototransduction.	confident	P51842

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004383 [MF]	guanylate cyclase activity	probable	GO:0009975, GO:0003824, GO:0016829, GO:0016849, GO:0003674
GO:0006182 [BP]	cGMP biosynthetic process	probable	GO:0009187, GO:0044249, GO:0034641, GO:0009165, GO:0044237, GO:0072521, GO:0072522, GO:1901362, GO:0046068, GO:1901360, GO:1901576, GO:0044710, GO:0052652, GO:0009259, GO:0008150, GO:0071704, GO:0009190, GO:0018130, GO:0009987, GO:0006139, GO:0006793, GO:0006725, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:0044281
GO:0008188 [MF]	neuropeptide receptor activity	probable	GO:0008528, GO:0004930, GO:0030594, GO:0038023, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0009897 [CC]	external side of plasma membrane	probable	GO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0000302 [BP]	response to reactive oxygen species	probable	GO:1901700, GO:0050896, GO:0006950, GO:0008150, GO:0042221, GO:0006979
GO:0035556 [BP]	intracellular signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0070026 [MF]	nitric oxide binding	probable	GO:0003674, GO:0005488
GO:0070025 [MF]	carbon monoxide binding	probable	GO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0016941 [MF]	natriuretic peptide receptor activity	probable	GO:0038023, GO:0060089, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0006171 [BP]	cAMP biosynthetic process	probable	GO:0009187, GO:0044249, GO:0034641, GO:0009165, GO:0044237, GO:0072521, GO:0072522, GO:1901362, GO:0009259, GO:1901360, GO:1901576, GO:0044710, GO:0052652, GO:0008150, GO:0071704, GO:0009190, GO:0018130, GO:0046058, GO:0006139, GO:0006793, GO:0006725, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0009987, GO:0006753, GO:0044281
GO:0008217 [BP]	regulation of blood pressure	probable	GO:0032501, GO:0044707, GO:0008015, GO:0003013, GO:0008150, GO:0065007, GO:0065008, GO:0044699, GO:0003008
GO:0044767 [BP]	single-organism developmental process	probable	GO:0032502, GO:0008150, GO:0044699
GO:0048522 [BP]	positive regulation of cellular process	probable	GO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0015643 [MF]	toxic substance binding	probable	GO:0003674, GO:0005488
GO:0007168 [BP]	receptor guanylyl cyclase signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0044297 [CC]	cell body	probable	GO:0005575, GO:0044464, GO:0005623
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0017046 [MF]	peptide hormone binding	probable	GO:0033218, GO:0003674, GO:0042277, GO:0042562, GO:0005488
GO:0048731 [BP]	system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0043679 [CC]	axon terminus	probable	GO:0044306, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0019220 [BP]	regulation of phosphate metabolic process	probable	GO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0048519 [BP]	negative regulation of biological process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0042127 [BP]	regulation of cell proliferation	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0019901 [MF]	protein kinase binding	probable	GO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0005525 [MF]	GTP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006184 [BP]	GTP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0080090 [BP]	regulation of primary metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0004016 [MF]	adenylate cyclase activity	probable	GO:0009975, GO:0003824, GO:0016829, GO:0016849, GO:0003674
GO:0016043 [BP]	cellular component organization	probable	GO:0008150, GO:0071840
GO:0072372 [CC]	primary cilium	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UVJ, chain A
Confidence level:very confident
Coverage over the Query: 164-353
View the alignment between query and template
View the model in PyMOL

Template: 1Y10, chain A
Confidence level:very confident
Coverage over the Query: 125-351
View the alignment between query and template
View the model in PyMOL

Template: 3HLS, chain A
Confidence level:confident
Coverage over the Query: 65-110
View the alignment between query and template
View the model in PyMOL

Template: 3OZ6, chain A
Confidence level:probable
Coverage over the Query: 1-28,41-93
View the alignment between query and template
View the model in PyMOL