Diaphorina citri psyllid: psy13820


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------
MRQCWAEPPDMRPDFNEVNDLFKTLNQGRGRGHLLLLSLRYKNPHLGLRLKSLLYIDSPRKVNFVDTMFQMLEKYSNNLEDLIRERTEQLDIEKKKTEQLLNRMLPRKVNFVDTMFQMLEKYSNNLEDLIRERTEQLDIEKKKTEQLLNRMLPSSVAEKLKLGMPVDPEDFREVTIYFSDIVGFTTISAYSTPFEVVDLLNDLYTCFDATINAYNVYKVETIGDAYMVVGGLPVRIPDHADQIATMALDLLHHSGRFKIRHLPYTPLRLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRLESTGAPWRIHLSADTKAKLDQVGDYQLEYRGETELKGKGKMPTYWLLGKKGFYKELPTPPPLGDSHGLDENLILYGRTGPSTTIDLSPTEARSNHSSRSLQTSPGPGRTSQEHAVQLHRSPRNNGKSQTQKTSQNKILSQILSLDSTMEDATRLSAHKKYKYMKQNTFDSCFYIDMRDGYSLET
ccccccccccccccccccHHHHHHHccccccccHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccEEEEcccccHHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEcccccEEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEccccccccccccccccccccccccHHHHHHHHccccccccEEEcHHHHHHHHHcccEEEEECccEEEEcccEEEEEEEEccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccHHHHHHHccccHHHHHcccccccccccccccccccccc
*RQCWAEPPDMR*****VNDLFKTLNQGRGRGHLLLLSLRYKNPHLGLRLKSLLYIDSPRKVNFVDTMFQMLEKYSNNLEDLIRERTEQLDIEKKKTEQLLNRMLPRKVNFVDTMFQMLEKYSNNLEDLIRERTEQLDIEKKKTEQLLNRMLPSSVAEKLKLGMPVDPEDFREVTIYFSDIVGFTTISAYSTPFEVVDLLNDLYTCFDATINAYNVYKVETIGDAYMVVGGLPVRIPDHADQIATMALDLLHHSGRFKIRHLPYTPLRLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRLESTGAPWRIHLSADTKAKLDQVGDYQLEYRGETELKGKGKMPTYWLLGKKGFY*******************************************************************************************************HKKYKYMKQNTFDSCFYIDMRD******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRQCWAEPPDMRPDFNEVNDLFKTLNQGRGRGHLLLLSLRYKNPHLGLRLKSLLYIDSPRKVNFxxxxxxxxxxxxxxxxxxxxxxxxxxxxEKKKTEQLLNRMLPRKVNFxxxxxxxxxxxxxxxxxxxxxxxxxxxxEKKKTEQLLNRMLPSSVAEKLKLGMPVDPEDFREVTIYFSDIVGFTTISAYSTPFEVVDLLNDLYTCFDATINAYNVYKVETIGDAYMVVGGLPVRIPDHADQIATMALDLLHHSGRFKIRHLPYTPLRLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRLESTGAPWRIHLSADTKAKLDQVGDYQLEYRGETELKGKGKMPTYWLLGKKGFYKELPTPPPLGDSHGLDENLILYGRTGPSTTIDLSPTEARSNHSSRSLQTSPGPGRTSQEHAVQLHRSPRNNGKSQTQKTSQNKILSQILSLDSTMEDATRLSAHKKYKYMKQNTFDSCFYIDMRDGYSLET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Retinal guanylyl cyclase 2 Probably plays a specific functional role in the rods and/or cones of photoreceptors. It may be the enzyme involved in the resynthesis of cGMP required for recovery of the dark state after phototransduction.confidentP51841
Retinal guanylyl cyclase 2 Probably plays a specific functional role in the rods and/or cones of photoreceptors. It may be the enzyme involved in the resynthesis of cGMP required for recovery of the dark state after phototransduction.confidentO02740
Retinal guanylyl cyclase 2 Probably plays a specific functional role in the rods and/or cones of photoreceptors. It may be the enzyme involved in the resynthesis of cGMP required for recovery of the dark state after phototransduction.confidentP51842

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004383 [MF]guanylate cyclase activityprobableGO:0009975, GO:0003824, GO:0016829, GO:0016849, GO:0003674
GO:0006182 [BP]cGMP biosynthetic processprobableGO:0009187, GO:0044249, GO:0034641, GO:0009165, GO:0044237, GO:0072521, GO:0072522, GO:1901362, GO:0046068, GO:1901360, GO:1901576, GO:0044710, GO:0052652, GO:0009259, GO:0008150, GO:0071704, GO:0009190, GO:0018130, GO:0009987, GO:0006139, GO:0006793, GO:0006725, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:0044281
GO:0008188 [MF]neuropeptide receptor activityprobableGO:0008528, GO:0004930, GO:0030594, GO:0038023, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0000302 [BP]response to reactive oxygen speciesprobableGO:1901700, GO:0050896, GO:0006950, GO:0008150, GO:0042221, GO:0006979
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0070026 [MF]nitric oxide bindingprobableGO:0003674, GO:0005488
GO:0070025 [MF]carbon monoxide bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0016941 [MF]natriuretic peptide receptor activityprobableGO:0038023, GO:0060089, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0006171 [BP]cAMP biosynthetic processprobableGO:0009187, GO:0044249, GO:0034641, GO:0009165, GO:0044237, GO:0072521, GO:0072522, GO:1901362, GO:0009259, GO:1901360, GO:1901576, GO:0044710, GO:0052652, GO:0008150, GO:0071704, GO:0009190, GO:0018130, GO:0046058, GO:0006139, GO:0006793, GO:0006725, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0009987, GO:0006753, GO:0044281
GO:0008217 [BP]regulation of blood pressureprobableGO:0032501, GO:0044707, GO:0008015, GO:0003013, GO:0008150, GO:0065007, GO:0065008, GO:0044699, GO:0003008
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0015643 [MF]toxic substance bindingprobableGO:0003674, GO:0005488
GO:0007168 [BP]receptor guanylyl cyclase signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0044297 [CC]cell bodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0017046 [MF]peptide hormone bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0042562, GO:0005488
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0043679 [CC]axon terminusprobableGO:0044306, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0019220 [BP]regulation of phosphate metabolic processprobableGO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006184 [BP]GTP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0004016 [MF]adenylate cyclase activityprobableGO:0009975, GO:0003824, GO:0016829, GO:0016849, GO:0003674
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0072372 [CC]primary ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UVJ, chain A
Confidence level:very confident
Coverage over the Query: 164-353
View the alignment between query and template
View the model in PyMOL
Template: 1Y10, chain A
Confidence level:very confident
Coverage over the Query: 125-351
View the alignment between query and template
View the model in PyMOL
Template: 3HLS, chain A
Confidence level:confident
Coverage over the Query: 65-110
View the alignment between query and template
View the model in PyMOL
Template: 3OZ6, chain A
Confidence level:probable
Coverage over the Query: 1-28,41-93
View the alignment between query and template
View the model in PyMOL