Diaphorina citri psyllid: psy13824

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------

MKNLILCCSFVLYYENGEEELNCCCQPIRRKWVRLFENLTTNLGYFCWGKGTPQSHPNNMNRTSKWIFPVVMSSSKGRHGHLFKFIAILLVASVWICLRYGNRIRRFHRPSSQTFTVNYSANTFRMDGRPFRFVSGEFHYFRSPQERWREILRKIRSAGLNAVSTYVGWSSHEAQPGTYSFDGHRDVEYFMRLAAEEGLYVLLYSGFSWTMKSSWDGTCIGFLWTK

cccEEEEEEEEEEEEccccccccccHHHHHHHHHHHHHHcccccCEECccccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEECccEEEEccCEEEEEEECcccccccHHHHHHHHHHHHHccccEEEEEcccccccccccCEECcccccHHHHHHHHHHcccEEEEEccccccEEEccccccccccccc

*KNLILCCSFVLYYENGEEELNCCCQPIRRKWVRLFENLTTNLGYFCWGKG***********TSKWIFPVVMSSSKGRHGHLFKFIAILLVASVWICLRYGNRIRRFHRPSSQTFTVNYSANTFRMDGRPFRFVSGEFHYFRSPQERWREILRKIRSAGLNAVSTYVGWSSHEAQPGTYSFDGHRDVEYFMRLAAEEGLYVLLYSGFSWTMKSSWDGTCIGFLWTK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Beta-galactosidase	Cleaves beta-linked terminal galactosyl residues from gangliosides, glycoproteins, and glycosaminoglycans.	confident	Q9TRY9
Beta-galactosidase	Cleaves beta-linked terminal galactosyl residues from gangliosides, glycoproteins, and glycosaminoglycans.	confident	P23780

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005773 [CC]	vacuole	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008152 [BP]	metabolic process	probable	GO:0008150

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3THD, chain A
Confidence level:very confident
Coverage over the Query: 112-226
View the alignment between query and template
View the model in PyMOL