Psyllid ID: psy13824
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 226 | ||||||
| 328711635 | 712 | PREDICTED: beta-galactosidase-like [Acyr | 0.553 | 0.175 | 0.44 | 3e-26 | |
| 357626884 | 2861 | putative carbamoyl-phosphate synthase la | 0.398 | 0.031 | 0.577 | 2e-25 | |
| 328721397 | 628 | PREDICTED: beta-galactosidase-like [Acyr | 0.433 | 0.156 | 0.530 | 2e-24 | |
| 193695178 | 640 | PREDICTED: beta-galactosidase-like [Acyr | 0.424 | 0.15 | 0.520 | 2e-24 | |
| 301767332 | 668 | PREDICTED: beta-galactosidase-like [Ailu | 0.451 | 0.152 | 0.519 | 4e-24 | |
| 307188518 | 624 | Beta-galactosidase [Camponotus floridanu | 0.429 | 0.155 | 0.544 | 5e-24 | |
| 281352249 | 626 | hypothetical protein PANDA_007660 [Ailur | 0.424 | 0.153 | 0.541 | 1e-23 | |
| 345487997 | 638 | PREDICTED: beta-galactosidase-like [Naso | 0.526 | 0.186 | 0.442 | 1e-23 | |
| 3025876 | 662 | lysosomal beta-galactosidase [Canis lupu | 0.451 | 0.154 | 0.519 | 2e-23 | |
| 83415088 | 668 | beta-galactosidase precursor [Canis lupu | 0.451 | 0.152 | 0.519 | 2e-23 |
| >gi|328711635|ref|XP_001944394.2| PREDICTED: beta-galactosidase-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 124 bits (311), Expect = 3e-26, Method: Composition-based stats.
Identities = 55/125 (44%), Positives = 83/125 (66%)
Query: 82 LFKFIAILLVASVWICLRYGNRIRRFHRPSSQTFTVNYSANTFRMDGRPFRFVSGEFHYF 141
LF + + V +++ +R G+ + + +TFTV+Y N F DG+ FR+VSG HYF
Sbjct: 34 LFVILKVAFVYILYVLIRNGSESKETPEVAERTFTVDYERNEFLKDGQVFRYVSGSLHYF 93
Query: 142 RSPQERWREILRKIRSAGLNAVSTYVGWSSHEAQPGTYSFDGHRDVEYFMRLAAEEGLYV 201
R P+ W++ ++K++ AGLNAVSTYV WS HE PG Y+F+ D+EYF++L +EG+Y+
Sbjct: 94 RVPKPYWKDRIQKMKVAGLNAVSTYVEWSLHEPYPGVYNFEDFADLEYFLKLVQDEGMYL 153
Query: 202 LLYSG 206
LL G
Sbjct: 154 LLRPG 158
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357626884|gb|EHJ76789.1| putative carbamoyl-phosphate synthase large chain [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|328721397|ref|XP_003247292.1| PREDICTED: beta-galactosidase-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|193695178|ref|XP_001948549.1| PREDICTED: beta-galactosidase-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|301767332|ref|XP_002919083.1| PREDICTED: beta-galactosidase-like [Ailuropoda melanoleuca] | Back alignment and taxonomy information |
|---|
| >gi|307188518|gb|EFN73255.1| Beta-galactosidase [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|281352249|gb|EFB27833.1| hypothetical protein PANDA_007660 [Ailuropoda melanoleuca] | Back alignment and taxonomy information |
|---|
| >gi|345487997|ref|XP_001602984.2| PREDICTED: beta-galactosidase-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|3025876|gb|AAC12775.1| lysosomal beta-galactosidase [Canis lupus familiaris] | Back alignment and taxonomy information |
|---|
| >gi|83415088|ref|NP_001032730.1| beta-galactosidase precursor [Canis lupus familiaris] gi|94730362|sp|Q9TRY9.3|BGAL_CANFA RecName: Full=Beta-galactosidase; AltName: Full=Acid beta-galactosidase; Short=Lactase; Flags: Precursor gi|76470548|gb|ABA43388.1| lysosomal beta-galactosidase [Canis lupus familiaris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 226 | ||||||
| UNIPROTKB|F1MUF4 | 653 | GLB1 "Beta-galactosidase" [Bos | 0.522 | 0.180 | 0.462 | 3.1e-25 | |
| UNIPROTKB|Q58D55 | 653 | GLB1 "Beta-galactosidase" [Bos | 0.522 | 0.180 | 0.462 | 3.1e-25 | |
| UNIPROTKB|Q9TRY9 | 668 | GLB1 "Beta-galactosidase" [Can | 0.526 | 0.178 | 0.466 | 5.3e-25 | |
| UNIPROTKB|F1PWH9 | 642 | GLB1 "Beta-galactosidase" [Can | 0.424 | 0.149 | 0.541 | 1e-24 | |
| UNIPROTKB|Q5ZLM4 | 385 | GLB1 "Uncharacterized protein" | 0.415 | 0.244 | 0.510 | 5.3e-24 | |
| RGD|1597145 | 647 | Glb1 "galactosidase, beta 1" [ | 0.442 | 0.154 | 0.49 | 4.4e-23 | |
| UNIPROTKB|E1BUL0 | 652 | GLB1 "Beta-galactosidase" [Gal | 0.415 | 0.144 | 0.510 | 4.5e-23 | |
| MGI|MGI:88151 | 647 | Glb1 "galactosidase, beta 1" [ | 0.424 | 0.148 | 0.510 | 9.2e-23 | |
| FB|FBgn0001089 | 672 | Gal "beta galactosidase" [Dros | 0.429 | 0.144 | 0.5 | 1.3e-22 | |
| UNIPROTKB|C9JF15 | 102 | GLB1 "Beta-galactosidase" [Hom | 0.407 | 0.901 | 0.510 | 2.6e-22 |
| UNIPROTKB|F1MUF4 GLB1 "Beta-galactosidase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 295 (108.9 bits), Expect = 3.1e-25, P = 3.1e-25
Identities = 55/119 (46%), Positives = 79/119 (66%)
Query: 88 ILLVASVWICLRYGNRIRRFHRPSSQTFTVNYSANTFRMDGRPFRFVSGEFHYFRSPQER 147
+ L+A + + L G+ R H + +TF ++Y N F DG+PFR++SG HYFR P+
Sbjct: 5 VRLLALLLVPLLLGSA-RGLHNATQRTFQIDYRRNRFLKDGQPFRYISGSIHYFRVPRFY 63
Query: 148 WREILRKIRSAGLNAVSTYVGWSSHEAQPGTYSFDGHRDVEYFMRLAAEEGLYVLLYSG 206
W++ L K++ AGLNA+ TYV W+ HE QPG Y+F G DVE+F++LA E GL V+L G
Sbjct: 64 WKDRLLKMKMAGLNAIQTYVAWNFHELQPGRYNFSGDHDVEHFIQLAHELGLLVILRPG 122
|
|
| UNIPROTKB|Q58D55 GLB1 "Beta-galactosidase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9TRY9 GLB1 "Beta-galactosidase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PWH9 GLB1 "Beta-galactosidase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZLM4 GLB1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1597145 Glb1 "galactosidase, beta 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BUL0 GLB1 "Beta-galactosidase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88151 Glb1 "galactosidase, beta 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0001089 Gal "beta galactosidase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JF15 GLB1 "Beta-galactosidase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 226 | |||
| pfam01301 | 318 | pfam01301, Glyco_hydro_35, Glycosyl hydrolases fam | 2e-33 | |
| COG1874 | 673 | COG1874, LacA, Beta-galactosidase [Carbohydrate tr | 2e-16 | |
| PLN03059 | 840 | PLN03059, PLN03059, beta-galactosidase; Provisiona | 9e-16 | |
| pfam02449 | 376 | pfam02449, Glyco_hydro_42, Beta-galactosidase | 3e-07 |
| >gnl|CDD|216423 pfam01301, Glyco_hydro_35, Glycosyl hydrolases family 35 | Back alignment and domain information |
|---|
Score = 121 bits (307), Expect = 2e-33
Identities = 40/81 (49%), Positives = 55/81 (67%)
Query: 123 TFRMDGRPFRFVSGEFHYFRSPQERWREILRKIRSAGLNAVSTYVGWSSHEAQPGTYSFD 182
+F +DG+ FR +SG HYFR P E W + L+K ++ GLN + TYV W+ HE +PG Y F
Sbjct: 1 SFLIDGQRFRLISGSIHYFRIPPEMWPDRLQKAKALGLNTIETYVFWNLHEPEPGQYDFS 60
Query: 183 GHRDVEYFMRLAAEEGLYVLL 203
G D+ F++LA E GLYV+L
Sbjct: 61 GILDLVKFIKLAQEAGLYVIL 81
|
Length = 318 |
| >gnl|CDD|224786 COG1874, LacA, Beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|166698 PLN03059, PLN03059, beta-galactosidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217042 pfam02449, Glyco_hydro_42, Beta-galactosidase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| PLN03059 | 840 | beta-galactosidase; Provisional | 100.0 | |
| PF01301 | 319 | Glyco_hydro_35: Glycosyl hydrolases family 35; Int | 100.0 | |
| KOG0496|consensus | 649 | 100.0 | ||
| COG1874 | 673 | LacA Beta-galactosidase [Carbohydrate transport an | 99.92 | |
| PF02449 | 374 | Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 | 99.68 | |
| PF02836 | 298 | Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM | 98.9 | |
| PRK10150 | 604 | beta-D-glucuronidase; Provisional | 98.62 | |
| PF00150 | 281 | Cellulase: Cellulase (glycosyl hydrolase family 5) | 98.6 | |
| PRK10340 | 1021 | ebgA cryptic beta-D-galactosidase subunit alpha; R | 98.44 | |
| PRK09525 | 1027 | lacZ beta-D-galactosidase; Reviewed | 98.42 | |
| TIGR03356 | 427 | BGL beta-galactosidase. | 98.25 | |
| COG3250 | 808 | LacZ Beta-galactosidase/beta-glucuronidase [Carboh | 98.19 | |
| PF03198 | 314 | Glyco_hydro_72: Glucanosyltransferase; InterPro: I | 97.86 | |
| PF01373 | 402 | Glyco_hydro_14: Glycosyl hydrolase family 14; Inte | 97.77 | |
| PLN02801 | 517 | beta-amylase | 97.62 | |
| PLN02803 | 548 | beta-amylase | 97.62 | |
| PLN00197 | 573 | beta-amylase; Provisional | 97.6 | |
| PLN02161 | 531 | beta-amylase | 97.6 | |
| PF13204 | 289 | DUF4038: Protein of unknown function (DUF4038); PD | 97.52 | |
| PF00232 | 455 | Glyco_hydro_1: Glycosyl hydrolase family 1; InterP | 97.52 | |
| PLN02705 | 681 | beta-amylase | 97.5 | |
| PLN02905 | 702 | beta-amylase | 97.49 | |
| PRK15014 | 477 | 6-phospho-beta-glucosidase BglA; Provisional | 97.35 | |
| PRK09852 | 474 | cryptic 6-phospho-beta-glucosidase; Provisional | 97.32 | |
| PF14488 | 166 | DUF4434: Domain of unknown function (DUF4434) | 97.28 | |
| PRK13511 | 469 | 6-phospho-beta-galactosidase; Provisional | 97.24 | |
| TIGR01233 | 467 | lacG 6-phospho-beta-galactosidase. This enzyme is | 97.22 | |
| PRK09593 | 478 | arb 6-phospho-beta-glucosidase; Reviewed | 97.17 | |
| PLN02814 | 504 | beta-glucosidase | 97.16 | |
| PLN02998 | 497 | beta-glucosidase | 97.12 | |
| PRK09589 | 476 | celA 6-phospho-beta-glucosidase; Reviewed | 97.06 | |
| PLN02849 | 503 | beta-glucosidase | 96.92 | |
| COG2730 | 407 | BglC Endoglucanase [Carbohydrate transport and met | 96.36 | |
| COG2723 | 460 | BglB Beta-glucosidase/6-phospho-beta-glucosidase/b | 96.32 | |
| PF00331 | 320 | Glyco_hydro_10: Glycosyl hydrolase family 10; Inte | 96.19 | |
| PF07745 | 332 | Glyco_hydro_53: Glycosyl hydrolase family 53; Inte | 95.46 | |
| smart00642 | 166 | Aamy Alpha-amylase domain. | 95.35 | |
| PRK09936 | 296 | hypothetical protein; Provisional | 94.95 | |
| PF05913 | 357 | DUF871: Bacterial protein of unknown function (DUF | 94.37 | |
| PF00128 | 316 | Alpha-amylase: Alpha amylase, catalytic domain; In | 94.31 | |
| PRK09441 | 479 | cytoplasmic alpha-amylase; Reviewed | 93.77 | |
| PF02638 | 311 | DUF187: Glycosyl hydrolase like GH101; InterPro: I | 92.16 | |
| cd06592 | 303 | GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact | 91.9 | |
| COG3867 | 403 | Arabinogalactan endo-1,4-beta-galactosidase [Carbo | 91.82 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 91.39 | |
| cd06593 | 308 | GH31_xylosidase_YicI YicI alpha-xylosidase is a gl | 91.33 | |
| COG1649 | 418 | Uncharacterized protein conserved in bacteria [Fun | 91.31 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 91.0 | |
| PF14871 | 132 | GHL6: Hypothetical glycosyl hydrolase 6 | 90.97 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 90.95 | |
| PRK10933 | 551 | trehalose-6-phosphate hydrolase; Provisional | 89.65 | |
| cd06591 | 319 | GH31_xylosidase_XylS XylS is a glycosyl hydrolase | 89.4 | |
| TIGR02403 | 543 | trehalose_treC alpha,alpha-phosphotrehalase. Treha | 89.24 | |
| COG3693 | 345 | XynA Beta-1,4-xylanase [Carbohydrate transport and | 88.89 | |
| cd06595 | 292 | GH31_xylosidase_XylS-like This family represents a | 88.74 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 87.95 | |
| PRK10785 | 598 | maltodextrin glucosidase; Provisional | 87.85 | |
| cd06600 | 317 | GH31_MGAM-like This family includes the following | 87.74 | |
| TIGR02456 | 539 | treS_nterm trehalose synthase. Trehalose synthase | 87.15 | |
| cd06598 | 317 | GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide | 87.01 | |
| PRK09505 | 683 | malS alpha-amylase; Reviewed | 86.96 | |
| cd06599 | 317 | GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 | 86.86 | |
| cd06604 | 339 | GH31_glucosidase_II_MalA Alpha-glucosidase II (alp | 86.8 | |
| PF13200 | 316 | DUF4015: Putative glycosyl hydrolase domain | 86.74 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 86.6 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 86.56 | |
| PF13199 | 559 | Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: | 86.0 | |
| cd06602 | 339 | GH31_MGAM_SI_GAA This family includes the followin | 85.85 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 85.85 | |
| cd06603 | 339 | GH31_GANC_GANAB_alpha This family includes the clo | 84.88 | |
| PRK13210 | 284 | putative L-xylulose 5-phosphate 3-epimerase; Revie | 84.67 | |
| cd06589 | 265 | GH31 The enzymes of glycosyl hydrolase family 31 ( | 84.47 | |
| TIGR02401 | 825 | trehalose_TreY malto-oligosyltrehalose synthase. T | 84.31 | |
| PLN02361 | 401 | alpha-amylase | 84.23 | |
| KOG2230|consensus | 867 | 84.16 | ||
| PRK14507 | 1693 | putative bifunctional 4-alpha-glucanotransferase/m | 84.07 | |
| PLN02960 | 897 | alpha-amylase | 84.05 | |
| PF01229 | 486 | Glyco_hydro_39: Glycosyl hydrolases family 39; Int | 83.89 | |
| PRK14511 | 879 | maltooligosyl trehalose synthase; Provisional | 83.49 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 83.33 | |
| KOG1065|consensus | 805 | 81.74 | ||
| PF01055 | 441 | Glyco_hydro_31: Glycosyl hydrolases family 31 ; In | 81.54 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 81.05 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 81.04 | |
| COG3589 | 360 | Uncharacterized conserved protein [Function unknow | 80.14 |
| >PLN03059 beta-galactosidase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-41 Score=338.68 Aligned_cols=112 Identities=31% Similarity=0.606 Sum_probs=107.8
Q ss_pred ceeEEEecCCeEEECCeeeEEeeccccCCCCCHhHHHHHHHHHHHcCCCEEEEeeecCcccCCCCeeeeeCcccHHHHHH
Q psy13824 113 QTFTVNYSANTFRMDGRPFRFVSGEFHYFRSPQERWREILRKIRSAGLNAVSTYVGWSSHEAQPGTYSFDGHRDVEYFMR 192 (226)
Q Consensus 113 r~~~v~~~~~~F~ldGkpf~ilgGeiHYfRvP~e~W~drL~kmKaaGlNTV~tyV~WnlHEPe~G~FDFsG~~DLd~FI~ 192 (226)
...+|++|+++|+|||+|++|++|++||||+||++|+|+|+||||+|+|||+||||||+|||+||+|||+|++||++||+
T Consensus 26 ~~~~v~~d~~~f~idG~p~~i~sG~iHY~R~~p~~W~d~L~k~Ka~GlNtV~tYV~Wn~HEp~~G~~dF~G~~DL~~Fl~ 105 (840)
T PLN03059 26 GSASVSYDHRAFIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVKFIK 105 (840)
T ss_pred ceeEEEEeCCEEEECCEEEEEEEeCcccCcCCHHHHHHHHHHHHHcCCCeEEEEecccccCCCCCeeeccchHHHHHHHH
Confidence 34578899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHcCCeEEEeeccccccccCCCCcccccccc
Q psy13824 193 LAAEEGLYVLLYSGFSWTMKSSWDGTCIGFLWT 225 (226)
Q Consensus 193 lA~e~GL~VILRpGPYIcaesT~~g~~PaWL~~ 225 (226)
+|+|+||+||||||||||||.+.+|. |+||.+
T Consensus 106 la~e~GLyvilRpGPYIcAEw~~GGl-P~WL~~ 137 (840)
T PLN03059 106 VVQAAGLYVHLRIGPYICAEWNFGGF-PVWLKY 137 (840)
T ss_pred HHHHcCCEEEecCCcceeeeecCCCC-chhhhc
Confidence 99999999999999999999998887 999964
|
|
| >PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >KOG0496|consensus | Back alignment and domain information |
|---|
| >COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK10150 beta-D-glucuronidase; Provisional | Back alignment and domain information |
|---|
| >PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK09525 lacZ beta-D-galactosidase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03356 BGL beta-galactosidase | Back alignment and domain information |
|---|
| >COG3250 LacZ Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane | Back alignment and domain information |
|---|
| >PF01373 Glyco_hydro_14: Glycosyl hydrolase family 14; InterPro: IPR001554 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PLN02801 beta-amylase | Back alignment and domain information |
|---|
| >PLN02803 beta-amylase | Back alignment and domain information |
|---|
| >PLN00197 beta-amylase; Provisional | Back alignment and domain information |
|---|
| >PLN02161 beta-amylase | Back alignment and domain information |
|---|
| >PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D | Back alignment and domain information |
|---|
| >PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PLN02705 beta-amylase | Back alignment and domain information |
|---|
| >PLN02905 beta-amylase | Back alignment and domain information |
|---|
| >PRK15014 6-phospho-beta-glucosidase BglA; Provisional | Back alignment and domain information |
|---|
| >PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional | Back alignment and domain information |
|---|
| >PF14488 DUF4434: Domain of unknown function (DUF4434) | Back alignment and domain information |
|---|
| >PRK13511 6-phospho-beta-galactosidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01233 lacG 6-phospho-beta-galactosidase | Back alignment and domain information |
|---|
| >PRK09593 arb 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >PLN02814 beta-glucosidase | Back alignment and domain information |
|---|
| >PLN02998 beta-glucosidase | Back alignment and domain information |
|---|
| >PRK09589 celA 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >PLN02849 beta-glucosidase | Back alignment and domain information |
|---|
| >COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >smart00642 Aamy Alpha-amylase domain | Back alignment and domain information |
|---|
| >PRK09936 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea | Back alignment and domain information |
|---|
| >PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK09441 cytoplasmic alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase | Back alignment and domain information |
|---|
| >COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose | Back alignment and domain information |
|---|
| >COG1649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >PF14871 GHL6: Hypothetical glycosyl hydrolase 6 | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK10933 trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate | Back alignment and domain information |
|---|
| >TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >PRK10785 maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II | Back alignment and domain information |
|---|
| >TIGR02456 treS_nterm trehalose synthase | Back alignment and domain information |
|---|
| >cd06598 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY | Back alignment and domain information |
|---|
| >PRK09505 malS alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 | Back alignment and domain information |
|---|
| >cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities | Back alignment and domain information |
|---|
| >PF13200 DUF4015: Putative glycosyl hydrolase domain | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PF13199 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 3VMO_A 3VMN_A 3VMP_A | Back alignment and domain information |
|---|
| >cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) | Back alignment and domain information |
|---|
| >PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed | Back alignment and domain information |
|---|
| >cd06589 GH31 The enzymes of glycosyl hydrolase family 31 (GH31) occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase | Back alignment and domain information |
|---|
| >TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase | Back alignment and domain information |
|---|
| >PLN02361 alpha-amylase | Back alignment and domain information |
|---|
| >KOG2230|consensus | Back alignment and domain information |
|---|
| >PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK14511 maltooligosyl trehalose synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG1065|consensus | Back alignment and domain information |
|---|
| >PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >COG3589 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 226 | ||||
| 3thc_A | 654 | Crystal Structure Of Human Beta-Galactosidase In Co | 9e-23 | ||
| 4e8c_A | 595 | Crystal Structure Of Streptococcal Beta-Galactosida | 2e-15 | ||
| 3d3a_A | 612 | Crystal Structure Of A Beta-Galactosidase From Bact | 5e-15 | ||
| 1tg7_A | 971 | Native Structure Of Beta-Galactosidase From Penicil | 4e-09 | ||
| 3og2_A | 1003 | Native Crystal Structure Of Trichoderma Reesei Beta | 2e-08 |
| >pdb|3THC|A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose Length = 654 | Back alignment and structure |
|
| >pdb|4E8C|A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose Length = 595 | Back alignment and structure |
| >pdb|3D3A|A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron Length = 612 | Back alignment and structure |
| >pdb|1TG7|A Chain A, Native Structure Of Beta-Galactosidase From Penicillium Sp. Length = 971 | Back alignment and structure |
| >pdb|3OG2|A Chain A, Native Crystal Structure Of Trichoderma Reesei Beta-Galactosidase Length = 1003 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 226 | |||
| 3og2_A | 1003 | Beta-galactosidase; TIM barrel domain, glycoside h | 2e-33 | |
| 3thd_A | 654 | Beta-galactosidase; TIM-barrel domain, glycosyl hy | 6e-33 | |
| 3d3a_A | 612 | Beta-galactosidase; protein structure initiative I | 9e-33 | |
| 4e8d_A | 595 | Glycosyl hydrolase, family 35; TIM barrel, beta-pr | 4e-32 | |
| 1tg7_A | 971 | Beta-galactosidase; TIM barrel domain, glycoside h | 1e-30 | |
| 3u7v_A | 552 | Beta-galactosidase; structural genomics, PSI-biolo | 1e-28 | |
| 3tty_A | 675 | Beta-GAL, beta-galactosidase; TIM barrel, glycosid | 7e-08 | |
| 1kwg_A | 645 | Beta-galactosidase; TIM barrel, glycoside hydrolas | 2e-07 | |
| 2osx_A | 481 | Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel | 5e-07 | |
| 1rh9_A | 373 | Endo-beta-mannanase; endo-beta-mannase, retaining, | 8e-07 | |
| 1uuq_A | 440 | Mannosyl-oligosaccharide glucosidase; hydrolase, m | 8e-05 | |
| 1fa2_A | 498 | Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 | 6e-04 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 9e-04 |
| >3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Length = 1003 | Back alignment and structure |
|---|
Score = 125 bits (315), Expect = 2e-33
Identities = 32/108 (29%), Positives = 49/108 (45%), Gaps = 1/108 (0%)
Query: 111 SSQTFTVNYSANTFRMDGRPFRFVSGEFHYFRSP-QERWREILRKIRSAGLNAVSTYVGW 169
V + ++ + G SGE H FR P + ++ KI++ G N VS YV W
Sbjct: 20 GPLQNIVTWDEHSLFVHGERVVIFSGEVHPFRLPVPSLYLDVFHKIKALGFNTVSFYVDW 79
Query: 170 SSHEAQPGTYSFDGHRDVEYFMRLAAEEGLYVLLYSGFSWTMKSSWDG 217
+ E +PG + DG +E F A + G+Y+L G + S G
Sbjct: 80 ALLEGKPGRFRADGIFSLEPFFEAATKAGIYLLARPGPYINAEVSGGG 127
|
| >3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Length = 654 | Back alignment and structure |
|---|
| >3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Length = 612 | Back alignment and structure |
|---|
| >4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Length = 595 | Back alignment and structure |
|---|
| >1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Length = 971 | Back alignment and structure |
|---|
| >3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Length = 552 | Back alignment and structure |
|---|
| >3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Length = 675 | Back alignment and structure |
|---|
| >1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Length = 645 | Back alignment and structure |
|---|
| >2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 | Back alignment and structure |
|---|
| >1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Length = 373 | Back alignment and structure |
|---|
| >1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Length = 440 | Back alignment and structure |
|---|
| >1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 Length = 498 | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Length = 516 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| 3thd_A | 654 | Beta-galactosidase; TIM-barrel domain, glycosyl hy | 100.0 | |
| 3og2_A | 1003 | Beta-galactosidase; TIM barrel domain, glycoside h | 100.0 | |
| 4e8d_A | 595 | Glycosyl hydrolase, family 35; TIM barrel, beta-pr | 100.0 | |
| 1tg7_A | 971 | Beta-galactosidase; TIM barrel domain, glycoside h | 100.0 | |
| 3d3a_A | 612 | Beta-galactosidase; protein structure initiative I | 99.97 | |
| 3u7v_A | 552 | Beta-galactosidase; structural genomics, PSI-biolo | 99.92 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 99.75 | |
| 3tty_A | 675 | Beta-GAL, beta-galactosidase; TIM barrel, glycosid | 99.66 | |
| 1kwg_A | 645 | Beta-galactosidase; TIM barrel, glycoside hydrolas | 99.57 | |
| 3pzg_A | 383 | Mannan endo-1,4-beta-mannosidase. glycosyl hydrol | 99.55 | |
| 1rh9_A | 373 | Endo-beta-mannanase; endo-beta-mannase, retaining, | 99.51 | |
| 1uuq_A | 440 | Mannosyl-oligosaccharide glucosidase; hydrolase, m | 99.37 | |
| 4awe_A | 387 | Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana | 99.37 | |
| 1qnr_A | 344 | Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt | 99.29 | |
| 3vup_A | 351 | Beta-1,4-mannanase; TIM barrel, digestive fluid, H | 99.29 | |
| 2osx_A | 481 | Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel | 99.28 | |
| 2c0h_A | 353 | Mannan endo-1,4-beta-mannosidase; hydrolase, signa | 99.27 | |
| 1ece_A | 358 | Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. | 98.98 | |
| 2w61_A | 555 | GAS2P, glycolipid-anchored surface protein 2; glyc | 98.96 | |
| 4hty_A | 359 | Cellulase; (alpha/beta)8 barrel, family 5 endogluc | 98.93 | |
| 1egz_A | 291 | Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL | 98.88 | |
| 1tvn_A | 293 | Cellulase, endoglucanase G; glycoside hydrolase, C | 98.87 | |
| 3cmg_A | 667 | Putative beta-galactosidase; structural genomics, | 98.87 | |
| 3fn9_A | 692 | Putative beta-galactosidase; structural genomics, | 98.78 | |
| 1yq2_A | 1024 | Beta-galactosidase; glycosyl hydrolase family 2, T | 98.74 | |
| 3hn3_A | 613 | Beta-G1, beta-glucuronidase; lysosomal enzyme, aci | 98.73 | |
| 3gm8_A | 801 | Glycoside hydrolase family 2, candidate beta-GLYC; | 98.73 | |
| 3lpf_A | 605 | Beta-glucuronidase; alpha/beta barrel, sugar-bindi | 98.7 | |
| 1qox_A | 449 | Beta-glucosidase; hydrolase, cellulose degradation | 98.7 | |
| 3qho_A | 458 | Endoglucanase, 458AA long hypothetical endo-1,4-be | 98.69 | |
| 2o9p_A | 454 | Beta-glucosidase B; family 1 glycoside hydrolase; | 98.69 | |
| 2whl_A | 294 | Beta-mannanase, baman5; glycoside hydrolase, hydro | 98.69 | |
| 1vff_A | 423 | Beta-glucosidase; glycosyl hydrolase, membrane-bou | 98.69 | |
| 3jug_A | 345 | Beta-mannanase; TIM-barrel, glycosidase, hydrolase | 98.62 | |
| 2e9l_A | 469 | Cytosolic beta-glucosidase; novel cytosolic neutra | 98.6 | |
| 3aof_A | 317 | Endoglucanase; glycosyl hydrolase family 5, cellul | 98.6 | |
| 2je8_A | 848 | Beta-mannosidase; glycoside hydrolase, hydrolase; | 98.57 | |
| 1wcg_A | 464 | Thioglucosidase, myrosinase; aphid, beta-glucosida | 98.57 | |
| 3pzt_A | 327 | Endoglucanase; alpha/beta barrel, glycosyl hydrola | 98.56 | |
| 1bqc_A | 302 | Protein (beta-mannanase); glycosyl hydrolase, fami | 98.56 | |
| 3apg_A | 473 | Beta-glucosidase; TIM barrel, hydrolase, sugar bin | 98.55 | |
| 2j78_A | 468 | Beta-glucosidase A; family 1, hydrolase, inhibitor | 98.55 | |
| 3ahx_A | 453 | Beta-glucosidase A; cellulases, glycosyl hydrolase | 98.55 | |
| 3fj0_A | 465 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase | 98.54 | |
| 1xyz_A | 347 | 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola | 98.54 | |
| 1qvb_A | 481 | Beta-glycosidase; TIM-barrel, thermostable, hydrol | 98.54 | |
| 1nq6_A | 302 | XYS1; glycoside hydrolase family 10, xylanase, xyl | 98.53 | |
| 2dep_A | 356 | Xylanase B, thermostable celloxylanase; glycosidas | 98.53 | |
| 2uwf_A | 356 | Endoxylanase, alkaline active endoxylanase; hydrol | 98.5 | |
| 1jz7_A | 1023 | Lactase, beta-galactosidase, LACZ; TIM barrel (alp | 98.48 | |
| 3oba_A | 1032 | Beta-galactosidase; TIM barrel, tetramer, GH2, gly | 98.47 | |
| 1v08_A | 512 | Beta-glucosidase; glycoside hydrolase, dimboa-gluc | 98.47 | |
| 3bga_A | 1010 | Beta-galactosidase; NYSGXRC, protein structure ini | 98.47 | |
| 3cui_A | 315 | EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine | 98.45 | |
| 1vjz_A | 341 | Endoglucanase; TM1752, structural genomics, JCSG, | 98.44 | |
| 1v0l_A | 313 | Endo-1,4-beta-xylanase A; glycoside hydrolase fami | 98.43 | |
| 7a3h_A | 303 | Endoglucanase; hydrolase, cellulose degradation, g | 98.43 | |
| 2e3z_A | 465 | Beta-glucosidase; TIM barrel, glycoside hydrolase | 98.42 | |
| 1n82_A | 331 | Xylanase, intra-cellular xylanase; hydrolase; 1.45 | 98.42 | |
| 3ahy_A | 473 | Beta-glucosidase; cellulases, glycosyl hydrolase, | 98.41 | |
| 1e4m_M | 501 | Myrosinase MA1; hydrolase, family 1 glycosyl hydro | 98.41 | |
| 1cbg_A | 490 | Cyanogenic beta-glucosidase; hydrolase (O-glycosyl | 98.4 | |
| 2dga_A | 565 | Beta-glucosidase; alpha/beta barrel, hydrolase; 1. | 98.4 | |
| 1r85_A | 379 | Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A | 98.39 | |
| 2vzs_A | 1032 | CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, | 98.39 | |
| 2d1z_A | 436 | Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en | 98.38 | |
| 1e4i_A | 447 | Beta-glucosidase; hydrolase, family 1 glycosyl hyd | 98.38 | |
| 1ug6_A | 431 | Beta-glycosidase; glucosidase, atomic resolution, | 98.37 | |
| 1ur1_A | 378 | Endoxylanase; hydrolase, family 10, glycoside hydr | 98.37 | |
| 1ceo_A | 343 | Cellulase CELC; glycosyl hydrolase, family A/5 of | 98.35 | |
| 2cks_A | 306 | Endoglucanase E-5; carbohydrate metabolism, polysa | 98.34 | |
| 1pbg_A | 468 | PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g | 98.33 | |
| 2jf7_A | 532 | Strictosidine-O-beta-D-glucosidase; alkaloid, hydr | 98.33 | |
| 1v02_A | 565 | Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri | 98.31 | |
| 1i1w_A | 303 | Endo-1,4-beta-xylanase; xylan degradation, hydrola | 98.31 | |
| 1g01_A | 364 | Endoglucanase; alpha/beta barrel, TIM barrel, hydr | 98.31 | |
| 1ta3_B | 303 | Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), | 98.31 | |
| 1us2_A | 530 | Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca | 98.31 | |
| 3nco_A | 320 | Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 | 98.29 | |
| 1h1n_A | 305 | Endo type cellulase ENGI; hydrolase, glycosyl hydr | 98.29 | |
| 2y8k_A | 491 | Arabinoxylanase, carbohydrate binding family 6; hy | 98.29 | |
| 1wky_A | 464 | Endo-beta-1,4-mannanase; TIM barrel, catalytic dom | 98.28 | |
| 1h4p_A | 408 | Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca | 98.18 | |
| 2xhy_A | 479 | BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, | 98.16 | |
| 3ndz_A | 345 | Endoglucanase D; cellotriose, xylanase, carbohydra | 98.16 | |
| 3l55_A | 353 | B-1,4-endoglucanase/cellulase; putative beta-1,4-e | 98.16 | |
| 1w32_A | 348 | Endo-1,4-beta-xylanase A precursor; mutant, calciu | 98.14 | |
| 3n9k_A | 399 | Glucan 1,3-beta-glucosidase; aromatic entranceway/ | 98.13 | |
| 1edg_A | 380 | Endoglucanase A; family A, cellulases, xylanases, | 98.1 | |
| 4b3l_A | 479 | Beta-glucosidase; hydrolase, glycosidase, carbohyd | 98.09 | |
| 2jep_A | 395 | Xyloglucanase; family 5, plant cell WALL, hydrolas | 98.08 | |
| 3icg_A | 515 | Endoglucanase D; cellulase, xylanase, carbohydrate | 98.07 | |
| 1gnx_A | 479 | Beta-glucosidase; hydrolase, glycosyltransferase, | 98.06 | |
| 3ayr_A | 376 | Endoglucanase; TIM barrel, hydrolase, carbohydrate | 98.03 | |
| 3gnp_A | 488 | OS03G0212800 protein; beta-alpha barrel, glycosida | 98.0 | |
| 4hz8_A | 444 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba | 97.95 | |
| 3f5l_A | 481 | Beta-glucosidase; beta-alpha-barrels, glycosidase, | 97.93 | |
| 1fa2_A | 498 | Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 | 97.91 | |
| 1wdp_A | 495 | Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.2 | 97.91 | |
| 2xfr_A | 535 | Beta-amylase; hydrolase, carbohydrate metabolism, | 97.83 | |
| 3kzs_A | 463 | Glycosyl hydrolase family 5; structural genomics, | 97.82 | |
| 3emz_A | 331 | Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba | 97.81 | |
| 3qr3_A | 340 | Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A | 97.77 | |
| 1uhv_A | 500 | Beta-xylosidase; family 39 glycoside hydrolase, xy | 97.75 | |
| 1hjs_A | 332 | Beta-1,4-galactanase; 4-galactanases, family 53 gl | 97.72 | |
| 3ta9_A | 458 | Glycoside hydrolase family 1; TIM barrel, glucosid | 97.65 | |
| 1w91_A | 503 | Beta-xylosidase; MAD, seMet, tetramer, hydrolase; | 97.64 | |
| 1fob_A | 334 | Beta-1,4-galactanase; B/A barrel, glycosyl hydrola | 97.6 | |
| 3ptm_A | 505 | Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly | 97.48 | |
| 4atd_A | 513 | Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr | 97.48 | |
| 3civ_A | 343 | Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. | 97.4 | |
| 3vii_A | 487 | Beta-glucosidase; cellulases, glycosyl hydrolase, | 97.33 | |
| 3qom_A | 481 | 6-phospho-beta-glucosidase; structural genomics, P | 97.33 | |
| 4f8x_A | 335 | Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET | 97.24 | |
| 1ur4_A | 399 | Galactanase; hydrolase, beta-1, glycoside hydrolas | 97.21 | |
| 3niy_A | 341 | Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 | 97.16 | |
| 4dde_A | 480 | 6-phospho-beta-glucosidase; structural genomics, P | 97.15 | |
| 4h41_A | 340 | Putative alpha-L-fucosidase; hydrolase, carbohydra | 96.84 | |
| 4a3y_A | 540 | Raucaffricine-O-beta-D-glucosidase; hydrolase, alk | 96.75 | |
| 3ro8_A | 341 | Endo-1,4-beta-xylanase; glycosyl hydrolase family | 96.73 | |
| 3u7b_A | 327 | Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET | 96.54 | |
| 4ekj_A | 500 | Beta-xylosidase; TIM-barrel fold, hemicellulase, h | 96.41 | |
| 1uwi_A | 489 | Beta-galactosidase; hydrolase, beta-glycosidase, g | 96.01 | |
| 4ha4_A | 489 | Beta-galactosidase; TIM barrel, beta-glycosidase, | 96.0 | |
| 3gyc_A | 393 | Putative glycoside hydrolase; YP_001304622.1, stru | 95.62 | |
| 4gqr_A | 496 | Pancreatic alpha-amylase; glycosyl hydrolase, diab | 95.06 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 95.04 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 94.81 | |
| 2w5f_A | 540 | Endo-1,4-beta-xylanase Y; cellulosome, glycosidase | 94.69 | |
| 1g94_A | 448 | Alpha-amylase; beta-alpha-8-barrel, 3 domain struc | 94.55 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 94.4 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 94.34 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 94.22 | |
| 2p0o_A | 372 | Hypothetical protein DUF871; structural genomics, | 94.18 | |
| 1mxg_A | 435 | Alpha amylase; hyperthermostable, family 13 glycos | 93.98 | |
| 1x7f_A | 385 | Outer surface protein; structural genomics, unknow | 93.94 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 93.69 | |
| 2xn2_A | 732 | Alpha-galactosidase; hydrolase, glycosidase; HET: | 93.62 | |
| 1jae_A | 471 | Alpha-amylase; glycosidase, carbohydrate metabolis | 93.14 | |
| 3mi6_A | 745 | Alpha-galactosidase; NESG, structural genomics, PS | 93.09 | |
| 2yfo_A | 720 | Alpha-galactosidase-sucrose kinase agask; hydrolas | 92.37 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 91.87 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 91.83 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 91.28 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 91.19 | |
| 4aie_A | 549 | Glucan 1,6-alpha-glucosidase; hydrolase, glycoside | 91.14 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 91.1 | |
| 4acy_A | 382 | Endo-alpha-mannosidase; hydrolase, endomannosidase | 91.01 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 90.61 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 90.52 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 90.35 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 90.25 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 89.91 | |
| 2nt0_A | 497 | Glucosylceramidase; cerezyme, glucocerebrosidase, | 89.8 | |
| 3clw_A | 507 | Conserved exported protein; structural genomics, u | 89.74 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 89.69 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 89.68 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 89.52 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 89.47 | |
| 2y24_A | 383 | Xylanase; hydrolase, GH5 family, aldotetraouronic | 88.82 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 88.8 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 88.64 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 88.55 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 88.52 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 88.33 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 88.09 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 87.89 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 87.89 | |
| 1zy9_A | 564 | Alpha-galactosidase; TM1192, struc genomics, joint | 87.55 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 87.53 | |
| 4ad1_A | 380 | Glycosyl hydrolase family 71; glycoside hydrolase | 87.37 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 87.32 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 87.3 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 87.01 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 86.94 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 86.92 | |
| 1gjw_A | 637 | Maltodextrin glycosyltransferase; alpha-amylase, m | 86.42 | |
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 86.17 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 86.01 | |
| 4ba0_A | 817 | Alpha-glucosidase, putative, ADG31B; hydrolase; HE | 85.89 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 85.75 | |
| 3aam_A | 270 | Endonuclease IV, endoiv; DNA repair, base excision | 85.68 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 85.66 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 84.15 | |
| 3ktc_A | 333 | Xylose isomerase; putative sugar isomerase, struct | 83.97 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 83.93 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 83.87 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 83.8 | |
| 3obe_A | 305 | Sugar phosphate isomerase/epimerase; structural ge | 83.61 | |
| 3aal_A | 303 | Probable endonuclease 4; endoiv, DNA repair, base | 83.5 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 83.49 | |
| 3vmn_A | 643 | Dextranase; TIM barrel, immunoglobrin fold, greek- | 82.82 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 82.36 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 81.99 | |
| 3ngf_A | 269 | AP endonuclease, family 2; structural genomics, se | 81.66 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 81.58 | |
| 2g3m_A | 693 | Maltase, alpha-glucosidase; hydrolase, glycoside h | 80.89 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 80.88 | |
| 3lpp_A | 898 | Sucrase-isomaltase; glycoside hydrolase family 31, | 80.77 | |
| 3l4y_A | 875 | Maltase-glucoamylase, intestinal; glycoside hydrol | 80.28 |
| >3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.4e-38 Score=308.86 Aligned_cols=115 Identities=43% Similarity=0.804 Sum_probs=109.8
Q ss_pred CCceeEEEecCCeEEECCeeeEEeeccccCCCCCHhHHHHHHHHHHHcCCCEEEEeeecCcccCCCCeeeeeCcccHHHH
Q psy13824 111 SSQTFTVNYSANTFRMDGRPFRFVSGEFHYFRSPQERWREILRKIRSAGLNAVSTYVGWSSHEAQPGTYSFDGHRDVEYF 190 (226)
Q Consensus 111 ~~r~~~v~~~~~~F~ldGkpf~ilgGeiHYfRvP~e~W~drL~kmKaaGlNTV~tyV~WnlHEPe~G~FDFsG~~DLd~F 190 (226)
..|+++|+||+++|++||+|++++||++||+|+|+++|+|+|+||||+|+|||++||+||.|||+||+|||+|++||++|
T Consensus 5 ~~r~~~v~~d~~~f~ldGkp~~i~sG~~Hy~r~p~~~W~d~l~kmKa~G~NtV~~yv~W~~hEP~~G~fdF~g~~DL~~f 84 (654)
T 3thd_A 5 TQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYF 84 (654)
T ss_dssp -CCCEEEETTTTEEEETTEEECCEEEECCGGGSCGGGHHHHHHHHHHTTCSEEEEECCHHHHCSBTTBCCCSGGGCHHHH
T ss_pred CCCcEEEEEcCCEEEECCEEEEEEEEecccccCCHHHHHHHHHHHHHcCCCEEEEEechhhcCCCCCccCccchHHHHHH
Confidence 46899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHcCCeEEEeeccccccccCCCCccccccccC
Q psy13824 191 MRLAAEEGLYVLLYSGFSWTMKSSWDGTCIGFLWTK 226 (226)
Q Consensus 191 I~lA~e~GL~VILRpGPYIcaesT~~g~~PaWL~~~ 226 (226)
|++|+++||+||||||||||||+..+| +|+||.++
T Consensus 85 l~~a~~~GL~ViLr~GPyi~aEw~~GG-~P~WL~~~ 119 (654)
T 3thd_A 85 LRLAHELGLLVILRPGPYICAEWEMGG-LPAWLLEK 119 (654)
T ss_dssp HHHHHHTTCEEEEECCSCCCTTBGGGG-CCGGGGGS
T ss_pred HHHHHHcCCEEEeccCCccccccCCCc-CChHHhcC
Confidence 999999999999999999999988655 59999864
|
| >3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* | Back alignment and structure |
|---|
| >4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A | Back alignment and structure |
|---|
| >1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* | Back alignment and structure |
|---|
| >3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A | Back alignment and structure |
|---|
| >3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* | Back alignment and structure |
|---|
| >1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* | Back alignment and structure |
|---|
| >3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* | Back alignment and structure |
|---|
| >1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* | Back alignment and structure |
|---|
| >4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} | Back alignment and structure |
|---|
| >1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* | Back alignment and structure |
|---|
| >3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} | Back alignment and structure |
|---|
| >2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* | Back alignment and structure |
|---|
| >2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A | Back alignment and structure |
|---|
| >2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* | Back alignment and structure |
|---|
| >4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* | Back alignment and structure |
|---|
| >1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* | Back alignment and structure |
|---|
| >3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 | Back alignment and structure |
|---|
| >3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* | Back alignment and structure |
|---|
| >3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A | Back alignment and structure |
|---|
| >1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* | Back alignment and structure |
|---|
| >2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* | Back alignment and structure |
|---|
| >2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A | Back alignment and structure |
|---|
| >1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} | Back alignment and structure |
|---|
| >2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* | Back alignment and structure |
|---|
| >3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* | Back alignment and structure |
|---|
| >2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* | Back alignment and structure |
|---|
| >1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A | Back alignment and structure |
|---|
| >1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* | Back alignment and structure |
|---|
| >3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... | Back alignment and structure |
|---|
| >3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} | Back alignment and structure |
|---|
| >1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} | Back alignment and structure |
|---|
| >2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* | Back alignment and structure |
|---|
| >1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... | Back alignment and structure |
|---|
| >3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A | Back alignment and structure |
|---|
| >1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A | Back alignment and structure |
|---|
| >3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A | Back alignment and structure |
|---|
| >3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* | Back alignment and structure |
|---|
| >1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A | Back alignment and structure |
|---|
| >7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A | Back alignment and structure |
|---|
| >2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* | Back alignment and structure |
|---|
| >1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A | Back alignment and structure |
|---|
| >3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} | Back alignment and structure |
|---|
| >1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* | Back alignment and structure |
|---|
| >1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* | Back alignment and structure |
|---|
| >1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A | Back alignment and structure |
|---|
| >2vzs_A CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, glucosamine, glycoside hydrolase; HET: GCS; 1.85A {Amycolatopsis orientalis} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2x05_A* 2x09_A* 2vzo_A 2vzt_A* 2vzv_A* 2vzu_A* | Back alignment and structure |
|---|
| >2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A | Back alignment and structure |
|---|
| >1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* | Back alignment and structure |
|---|
| >1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A | Back alignment and structure |
|---|
| >1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* | Back alignment and structure |
|---|
| >1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A | Back alignment and structure |
|---|
| >2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* | Back alignment and structure |
|---|
| >1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* | Back alignment and structure |
|---|
| >2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A | Back alignment and structure |
|---|
| >1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* | Back alignment and structure |
|---|
| >1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A | Back alignment and structure |
|---|
| >1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* | Back alignment and structure |
|---|
| >1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A | Back alignment and structure |
|---|
| >3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* | Back alignment and structure |
|---|
| >1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A | Back alignment and structure |
|---|
| >2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 | Back alignment and structure |
|---|
| >1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* | Back alignment and structure |
|---|
| >1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A | Back alignment and structure |
|---|
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A | Back alignment and structure |
|---|
| >1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A | Back alignment and structure |
|---|
| >2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* | Back alignment and structure |
|---|
| >1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A | Back alignment and structure |
|---|
| >3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* | Back alignment and structure |
|---|
| >3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* | Back alignment and structure |
|---|
| >4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* | Back alignment and structure |
|---|
| >3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* | Back alignment and structure |
|---|
| >1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 | Back alignment and structure |
|---|
| >1wdp_A Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.27A {Glycine max} SCOP: c.1.8.1 PDB: 1bfn_A* 1q6c_A 1wdr_A* 1v3i_A* 1v3h_A* 1q6d_A* 1q6g_A* 1wdq_A* 1wds_A* 1q6e_A* 1q6f_A* 2dqx_A 1byb_A* 1bya_A* 1byc_A* 1byd_A* 1uko_A 1ukp_A 1btc_A* | Back alignment and structure |
|---|
| >2xfr_A Beta-amylase; hydrolase, carbohydrate metabolism, glycosyl hydrolase famil starch degradation, germination; 0.97A {Hordeum vulgare} PDB: 2xff_A 2xfy_A* 2xg9_A* 2xgb_A* 2xgi_A* 1b1y_A* | Back alignment and structure |
|---|
| >3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* | Back alignment and structure |
|---|
| >3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A | Back alignment and structure |
|---|
| >1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* | Back alignment and structure |
|---|
| >3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} | Back alignment and structure |
|---|
| >1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* | Back alignment and structure |
|---|
| >1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A | Back alignment and structure |
|---|
| >3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* | Back alignment and structure |
|---|
| >4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* | Back alignment and structure |
|---|
| >3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* | Back alignment and structure |
|---|
| >3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A | Back alignment and structure |
|---|
| >4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} | Back alignment and structure |
|---|
| >1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* | Back alignment and structure |
|---|
| >3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A | Back alignment and structure |
|---|
| >4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* | Back alignment and structure |
|---|
| >3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A | Back alignment and structure |
|---|
| >3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} | Back alignment and structure |
|---|
| >4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} | Back alignment and structure |
|---|
| >1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A | Back alignment and structure |
|---|
| >4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A | Back alignment and structure |
|---|
| >3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} | Back alignment and structure |
|---|
| >4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A | Back alignment and structure |
|---|
| >2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* | Back alignment and structure |
|---|
| >1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A | Back alignment and structure |
|---|
| >2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* | Back alignment and structure |
|---|
| >1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* | Back alignment and structure |
|---|
| >1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* | Back alignment and structure |
|---|
| >3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A | Back alignment and structure |
|---|
| >4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4acy_A Endo-alpha-mannosidase; hydrolase, endomannosidase, glycoside hydrolase, CAZY, enzyme-carbohydrate interaction, mannose; HET: MSE; 1.69A {Bacteroides thetaiotaomicron} PDB: 4acz_A 4ad0_A* 4acz_B | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A | Back alignment and structure |
|---|
| >2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... | Back alignment and structure |
|---|
| >3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2y24_A Xylanase; hydrolase, GH5 family, aldotetraouronic acid; HET: XYP GCV PG4 PGE; 1.39A {Erwinia chrysanthemi} PDB: 1nof_A* | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* | Back alignment and structure |
|---|
| >4ad1_A Glycosyl hydrolase family 71; glycoside hydrolase GH99, CAZY, enzyme-carbohydra interaction, mannose glycosidase inhibition; 1.90A {Bacteroides xylanisolvens} PDB: 4ad2_A* 4ad3_A* 4ad4_A* 4ad5_A* | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A | Back alignment and structure |
|---|
| >1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* | Back alignment and structure |
|---|
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >4ba0_A Alpha-glucosidase, putative, ADG31B; hydrolase; HET: 5GF PGE ARG; 1.85A {Cellvibrio japonicus} PDB: 4b9z_A* 4b9y_A* | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* | Back alignment and structure |
|---|
| >3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >3ktc_A Xylose isomerase; putative sugar isomerase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.54A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3aal_A Probable endonuclease 4; endoiv, DNA repair, base excision repair, TIM barrel, DNA DA endonuclease, hydrolase, metal-binding; 1.60A {Geobacillus kaustophilus} PDB: 1xp3_A | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >3vmn_A Dextranase; TIM barrel, immunoglobrin fold, greek-KEY-motif, glycoside H family 66, hydrolase; 1.60A {Streptococcus mutans} PDB: 3vmo_A* 3vmp_A* | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0 | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* | Back alignment and structure |
|---|
| >3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 226 | ||||
| d1tg7a5 | 354 | c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-ter | 2e-29 | |
| d1kwga2 | 393 | c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t | 1e-08 | |
| d1rh9a1 | 370 | c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycoper | 3e-08 | |
| d1uuqa_ | 410 | c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [Ta | 9e-05 | |
| d2c0ha1 | 350 | c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue | 2e-04 | |
| d1vema2 | 417 | c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus | 5e-04 | |
| d2vzsa5 | 339 | c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolato | 0.001 | |
| d1qnra_ | 344 | c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [T | 0.002 | |
| d1ceoa_ | 340 | c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm | 0.004 | |
| d1b1ya_ | 500 | c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare | 0.004 |
| >d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Length = 354 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Glycosyl hydrolases family 35 catalytic domain domain: Beta-galactosidase LacA, N-terminal domain species: Penicillium sp. [TaxId: 5081]
Score = 110 bits (275), Expect = 2e-29
Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
Query: 117 VNYSANTFRMDGRPFRFVSGEFHYFRSP-QERWREILRKIRSAGLNAVSTYVGWSSHEAQ 175
V + ++ ++G SGE H +R P + +I K+++ G N VS YV W+ E
Sbjct: 6 VTWDEHSIFVNGERLMIFSGEVHPYRLPVASLYIDIFEKVKALGFNCVSFYVDWALLEGN 65
Query: 176 PGTYSFDGHRDVEYFMRLAAEEGLYVLLYSGFSW 209
PG YS +G D++ F A E G+Y+L G
Sbjct: 66 PGHYSAEGIFDLQPFFDAAKEAGIYLLARPGPYI 99
|
| >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 | Back information, alignment and structure |
|---|
| >d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 370 | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Length = 410 | Back information, alignment and structure |
|---|
| >d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Length = 350 | Back information, alignment and structure |
|---|
| >d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Length = 417 | Back information, alignment and structure |
|---|
| >d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Length = 339 | Back information, alignment and structure |
|---|
| >d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Length = 344 | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 | Back information, alignment and structure |
|---|
| >d1b1ya_ c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 500 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| d1tg7a5 | 354 | Beta-galactosidase LacA, N-terminal domain {Penici | 100.0 | |
| d1kwga2 | 393 | A4 beta-galactosidase {Thermus thermophilus [TaxId | 99.69 | |
| d1rh9a1 | 370 | Beta-mannanase {Tomato (Lycopersicon esculentum) [ | 99.61 | |
| d1uuqa_ | 410 | Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | 99.53 | |
| d2c0ha1 | 350 | endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed | 99.36 | |
| d2vzsa5 | 339 | Exochitosanase CsxA {Amycolatopsis orientalis [Tax | 99.27 | |
| d1qnra_ | 344 | Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | 99.23 | |
| d1vema2 | 417 | Bacterial beta-amylase {Bacillus cereus [TaxId: 13 | 99.19 | |
| d1bhga3 | 304 | beta-Glucuronidase, domain 3 {Human (Homo sapiens) | 99.11 | |
| d1jz8a5 | 292 | beta-Galactosidase, domain 3 {Escherichia coli [Ta | 99.06 | |
| d1yq2a5 | 297 | beta-Galactosidase, domain 3 {Arthrobacter sp. c2- | 99.04 | |
| d2je8a5 | 348 | Five-domain beta-mannosidase, domain 3 {Bacteroide | 99.03 | |
| d1wkya2 | 297 | Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 | 98.95 | |
| d1bqca_ | 302 | Beta-mannanase {Thermomonospora fusca [TaxId: 2021 | 98.86 | |
| d1ecea_ | 358 | Endocellulase E1 {Acidothermus cellulolyticus [Tax | 98.8 | |
| d1tvna1 | 293 | Endoglucanase Cel5a {Pseudoalteromonas haloplankti | 98.75 | |
| d1egza_ | 291 | Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: | 98.6 | |
| d1hjsa_ | 332 | Beta-1,4-galactanase {Thielavia heterothallica, ak | 98.49 | |
| d7a3ha_ | 300 | Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId | 98.47 | |
| d1ceoa_ | 340 | Endoglucanase CelC {Clostridium thermocellum [TaxI | 98.43 | |
| d2pb1a1 | 394 | Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) | 98.4 | |
| d1vjza_ | 325 | Endoglucanase homologue TM1752 {Thermotoga maritim | 98.38 | |
| d1h4pa_ | 408 | Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom | 98.3 | |
| d1g01a_ | 357 | Alkaline cellulase K catalytic domain {Bacillus sp | 98.27 | |
| d1vffa1 | 423 | Beta-glucosidase A {Archaeon Pyrococcus horikoshii | 98.17 | |
| d1edga_ | 380 | Endoglucanase CelA {Clostridium cellulolyticum [Ta | 98.13 | |
| d1ug6a_ | 426 | Beta-glucosidase A {Thermus thermophilus [TaxId: 2 | 98.09 | |
| d1h1na_ | 305 | Endocellulase EngI {Thermoascus aurantiacus [TaxId | 98.08 | |
| d2j78a1 | 443 | Beta-glucosidase A {Thermotoga maritima [TaxId: 23 | 98.06 | |
| d1foba_ | 334 | Beta-1,4-galactanase {Fungus (Aspergillus aculeatu | 98.0 | |
| d1e4ia_ | 447 | Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 | 97.98 | |
| d1gnxa_ | 464 | Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] | 97.9 | |
| d1ur4a_ | 387 | Beta-1,4-galactanase {Bacillus licheniformis [TaxI | 97.84 | |
| d1cbga_ | 490 | Plant beta-glucosidase (myrosinase) {Creeping whit | 97.84 | |
| d1qoxa_ | 449 | Beta-glucosidase A {Bacillus circulans, subsp. alk | 97.8 | |
| d1wcga1 | 462 | Thioglucosidase {Cabbage aphid (Brevicoryne brassi | 97.75 | |
| d1b1ya_ | 500 | beta-Amylase {Barley (Hordeum vulgare) [TaxId: 451 | 97.72 | |
| d1fa2a_ | 498 | beta-Amylase {Sweet potato (Ipomoea batatas) [TaxI | 97.7 | |
| d1uhva2 | 346 | Beta-D-xylosidase, catalytic domain {Thermoanaerob | 97.69 | |
| d1wdpa1 | 490 | beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} | 97.69 | |
| d1v02a_ | 484 | Plant beta-glucosidase (myrosinase) {Sorghum bicol | 97.67 | |
| d1xyza_ | 320 | Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 | 97.61 | |
| d1pbga_ | 468 | 6-phospho-beta-D-galactosidase, PGAL {Lactococcus | 97.55 | |
| d1nq6a_ | 302 | Xylanase A, catalytic core {Streptomyces halstedii | 97.54 | |
| d1ud2a2 | 390 | Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta | 97.48 | |
| d1e4mm_ | 499 | Plant beta-glucosidase (myrosinase) {White mustard | 97.47 | |
| d1n82a_ | 330 | Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId | 97.36 | |
| d1v0la_ | 302 | Xylanase A, catalytic core {Streptomyces lividans | 97.28 | |
| d1vbua1 | 324 | Xylanase {Thermotoga maritima [TaxId: 2336]} | 97.21 | |
| d1fh9a_ | 312 | Xylanase A, catalytic core {Cellulomonas fimi [Tax | 97.1 | |
| d1uwsa_ | 489 | beta-Glycosidase {Archaeon Sulfolobus solfataricus | 97.0 | |
| d1ta3b_ | 301 | Xylanase A, catalytic core {Emericella nidulans (A | 96.99 | |
| d1r85a_ | 371 | Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: | 96.82 | |
| d1i1wa_ | 303 | Xylanase A, catalytic core {Thermoascus aurantiacu | 96.74 | |
| d1qvba_ | 481 | beta-Glycosidase {Archaeon Thermosphaera aggregans | 96.71 | |
| d1hvxa2 | 393 | Bacterial alpha-amylase {Bacillus stearothermophil | 96.62 | |
| d1gcya2 | 357 | G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase | 96.52 | |
| d1ur1a_ | 350 | Xylanase {Cellvibrio mixtus [TaxId: 39650]} | 96.42 | |
| d1jaea2 | 378 | Animal alpha-amylase {Yellow mealworm (Tenebrio mo | 96.38 | |
| d1ua7a2 | 344 | Bacterial alpha-amylase {Bacillus subtilis [TaxId: | 96.32 | |
| d1mxga2 | 361 | Bacterial alpha-amylase {Archaeon Pyrococcus woese | 96.31 | |
| d1ht6a2 | 347 | Plant alpha-amylase {Barley (Hordeum vulgare), AMY | 96.23 | |
| d1e43a2 | 393 | Bacterial alpha-amylase {Chimera (Bacillus amyloli | 96.2 | |
| d1us3a2 | 364 | Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] | 96.2 | |
| d1g94a2 | 354 | Bacterial alpha-amylase {Pseudoalteromonas halopla | 96.13 | |
| d2d3na2 | 394 | Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: | 95.93 | |
| d1hx0a2 | 403 | Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 | 95.67 | |
| d1qhoa4 | 407 | Cyclodextrin glycosyltransferase {Bacillus stearot | 95.48 | |
| d1x7fa2 | 244 | Outer surface protein, N-terminal domain {Bacillus | 95.27 | |
| d1zy9a2 | 348 | Alpha-galactosidase GalA catalytic domain {Thermot | 94.81 | |
| d1m53a2 | 478 | Isomaltulose synthase PalI {Klebsiella sp., lx3 [T | 94.44 | |
| d1h3ga3 | 422 | Cyclomaltodextrinase, central domain {Flavobacteri | 94.39 | |
| d1wzla3 | 382 | Maltogenic amylase, central domain {Thermoactinomy | 94.32 | |
| d2guya2 | 381 | Fungal alpha-amylases {Aspergillus oryzae, Taka-am | 94.12 | |
| d1gjwa2 | 572 | Maltosyltransferase {Thermotoga maritima [TaxId: 2 | 94.01 | |
| d1bf2a3 | 475 | Isoamylase, central domain {Pseudomonas amyloderam | 93.94 | |
| d1uoka2 | 479 | Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 | 93.86 | |
| d1eh9a3 | 400 | Glycosyltrehalose trehalohydrolase, central domain | 93.7 | |
| d1m7xa3 | 396 | 1,4-alpha-glucan branching enzyme, central domain | 93.52 | |
| d2aaaa2 | 381 | Fungal alpha-amylases {Aspergillus niger, acid amy | 93.47 | |
| d1lwha2 | 391 | 4-alpha-glucanotransferase {Thermotoga maritima [T | 93.44 | |
| d3bmva4 | 406 | Cyclodextrin glycosyltransferase {Thermoanaerobact | 93.41 | |
| d1ea9c3 | 382 | Maltogenic amylase, central domain {Bacillus sp., | 93.37 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 92.99 | |
| d1wzaa2 | 409 | Bacterial alpha-amylase {Halothermothrix orenii [T | 92.71 | |
| d1j0ha3 | 382 | Neopullulanase, central domain {Bacillus stearothe | 92.11 | |
| d1w32a_ | 346 | Xylanase A, catalytic core {Pseudomonas fluorescen | 91.21 | |
| d1nofa2 | 277 | Glycosyl hydrolase family 5 xylanase, catalytic do | 90.44 | |
| d1g5aa2 | 554 | Amylosucrase {Neisseria polysaccharea [TaxId: 489] | 88.71 | |
| d2f2ha4 | 338 | Putative glucosidase YicI, domain 2 {Escherichia c | 88.18 | |
| d1iv8a2 | 653 | Maltooligosyl trehalose synthase {Archaeon Sulfolo | 86.98 | |
| d2fhfa5 | 563 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 84.8 | |
| d1szna2 | 314 | Melibiase {Trichoderma reesei [TaxId: 51453]} | 83.91 |
| >d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Glycosyl hydrolases family 35 catalytic domain domain: Beta-galactosidase LacA, N-terminal domain species: Penicillium sp. [TaxId: 5081]
Probab=100.00 E-value=9.4e-35 Score=257.40 Aligned_cols=109 Identities=32% Similarity=0.565 Sum_probs=103.6
Q ss_pred EEEecCCeEEECCeeeEEeeccccCCCCC-HhHHHHHHHHHHHcCCCEEEEeeecCcccCCCCeeeeeCcccHHHHHHHH
Q psy13824 116 TVNYSANTFRMDGRPFRFVSGEFHYFRSP-QERWREILRKIRSAGLNAVSTYVGWSSHEAQPGTYSFDGHRDVEYFMRLA 194 (226)
Q Consensus 116 ~v~~~~~~F~ldGkpf~ilgGeiHYfRvP-~e~W~drL~kmKaaGlNTV~tyV~WnlHEPe~G~FDFsG~~DLd~FI~lA 194 (226)
.|++|+++|+||||||+|+||++||+|+| +++|+|+|++||++|+|+|+|||+|+.|||+||+|||+|..||++||++|
T Consensus 5 ~v~~d~~~~~~~G~~~~~~~~~~h~~r~~~~~~w~~~l~~mk~~G~n~vr~~~~W~~~ep~~g~~df~~~~~l~~~l~~a 84 (354)
T d1tg7a5 5 YVTWDEHSIFVNGERLMIFSGEVHPYRLPVASLYIDIFEKVKALGFNCVSFYVDWALLEGNPGHYSAEGIFDLQPFFDAA 84 (354)
T ss_dssp SEEECSSCEEETTEEECEEEEECCGGGSCCGGGHHHHHHHHHTTTCCEEEEECCHHHHCSBTTBCCCCGGGCSHHHHHHH
T ss_pred eEEEeCCEEEECCEEEEEEEEecCCCCCCCHHHHHHHHHHHHHcCCCEEEEecchhccCCCCCcccccchhhHHHHHHHH
Confidence 57899999999999999999999999997 89999999999999999999999999999999999999999999999999
Q ss_pred HHcCCeEEEeeccccccccCCCCcccccccc
Q psy13824 195 AEEGLYVLLYSGFSWTMKSSWDGTCIGFLWT 225 (226)
Q Consensus 195 ~e~GL~VILRpGPYIcaesT~~g~~PaWL~~ 225 (226)
+|+||+|||+||||+|++...++. |.|+..
T Consensus 85 ~~~Gl~vil~~g~~~~~~w~~~~~-p~~~~~ 114 (354)
T d1tg7a5 85 KEAGIYLLARPGPYINAEVSGGGF-PGWLQR 114 (354)
T ss_dssp HHHTCEEEEECCSCCCTTBGGGGC-CGGGGG
T ss_pred HHcCCEEEEcCCCCcCcccccCCC-Cccccc
Confidence 999999999999999998876655 889864
|
| >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} | Back information, alignment and structure |
|---|
| >d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} | Back information, alignment and structure |
|---|
| >d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} | Back information, alignment and structure |
|---|
| >d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} | Back information, alignment and structure |
|---|
| >d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} | Back information, alignment and structure |
|---|
| >d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} | Back information, alignment and structure |
|---|
| >d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} | Back information, alignment and structure |
|---|
| >d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} | Back information, alignment and structure |
|---|
| >d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} | Back information, alignment and structure |
|---|
| >d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} | Back information, alignment and structure |
|---|
| >d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} | Back information, alignment and structure |
|---|
| >d1b1ya_ c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1fa2a_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]} | Back information, alignment and structure |
|---|
| >d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} | Back information, alignment and structure |
|---|
| >d1wdpa1 c.1.8.1 (A:6-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} | Back information, alignment and structure |
|---|
| >d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} | Back information, alignment and structure |
|---|
| >d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} | Back information, alignment and structure |
|---|
| >d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} | Back information, alignment and structure |
|---|
| >d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} | Back information, alignment and structure |
|---|
| >d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} | Back information, alignment and structure |
|---|
| >d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1szna2 c.1.8.1 (A:1-314) Melibiase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|