Diaphorina citri psyllid: psy13845


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MTLYYIGGEVFAECLSDSSIFVQSPNCNQRYGWHPATVCKIPPVKRKTISCLLSGDLIMTSLFPFTPPIVKKLLGWKKGDGEDKYSEKAVKSLVKKLKKSNGLDELEKAITTQDPNTKCVTIPSARTDKGSTDLSNRSKGLPHVIYCRLWRWPSLQSHNELRSIDLCAFGFSLKRDQVCVNPYHYQRIHTQGICTCNVEREELGKMVENLTKNARTDKGSTDLSNRSKGLPHVIYCRLWRWPSLQSHNELRSIDLCAFGFSLKRDQVCVNPYHYQRIHGGYMSEDGDATDALSLSPSPAIPAGDTQPVMYCEPVFWCSISYYELNTRVGETFHASQPSISVDGFTDPSNSERFCLGLLSNVNRNHVVEQIRRHIGKGPSISVDGFTDPSNSERFCLGLLSNVNRNHVVEQIRRHIGKGVRSLSVAKEKLF
cEEEEEccEEEEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccEEEEccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccccCEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccEEEcccEEEEccccccccccccEEcccccccccHHHHHHHHccccccEEEEEcCCcccccccEEEEcccccccccHHHHHHccccccEEEEEEcccccc
MTLYYIGGEVFAECLSDSSIFVQSPNCNQRYGWHPATVCKIPPVKRKTISCLLSGDLIMTSLFPFTPPIVKKLLGWKK**G*DKYSEKAVKSLVKKLKKSNGLDELEKAITTQDPNTKCVTI***************SKGLPHVIYCRLWRWPSLQSHNELRSIDLCAFGFSLKRDQVCVNPYHYQRIHTQGICTCNVEREELGKMVENLTKNARTDKGST********LPHVIYCRLWRWPSLQS***L****L*********DQVCV*****************************AIPAGDTQPVMYCEPVFWCSISYYELNTRVGETFHASQPSISVDGFTDPSNSERFCLGLLSNVNRNHVVEQIRRHIGKGPSISVDGFTDPSNSERFCLGLLSNVNRNHVVEQIRRHIGKGVRSLSVAKEKL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLYYIGGEVFAECLSDSSIFVQSPNCNQRYGWHPATVCKIPPVKRKTISCLLSGDLIMTSLFPFTPPIVKKLLGWKKGDGEDKYSEKAVKSLVKKLKKSNGLDELEKAITTQDPNTKCVTIPSARTDKGSTDLSNRSKGLPHVIYCRLWRWPSLQSHNELRSIDLCAFGFSLKRDQVCVNPYHYQRIHTQGICTCNVEREELGKMVENLTKNARTDKGSTDLSNRSKGLPHVIYCRLWRWPSLQSHNELRSIDLCAFGFSLKRDQVCVNPYHYQRIHGGYMSEDGDATDALSLSPSPAIPAGDTQPVMYCEPVFWCSISYYELNTRVGETFHASQPSISVDGFTDPSNSERFCLGLLSNVNRNHVVEQIRRHIGKGPSISVDGFTDPSNSERFCLGLLSNVNRNHVVEQIRRHIGKGVRSLSVAKEKLF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mothers against decapentaplegic homolog 3 Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.confidentP84024
Mothers against decapentaplegic homolog 3 Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.confidentP84025
Mothers against decapentaplegic homolog 3 Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.confidentQ8BUN5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007178 [BP]transmembrane receptor protein serine/threonine kinase signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0003674 [MF]molecular_functionprobable
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OZJ, chain A
Confidence level:very confident
Coverage over the Query: 65-190
View the alignment between query and template
View the model in PyMOL
Template: 3GMJ, chain D
Confidence level:very confident
Coverage over the Query: 312-401
View the alignment between query and template
View the model in PyMOL
Template: 1OZJ, chain A
Confidence level:very confident
Coverage over the Query: 214-276
View the alignment between query and template
View the model in PyMOL
Template: 1DD1, chain A
Confidence level:very confident
Coverage over the Query: 351-428
View the alignment between query and template
View the model in PyMOL