Diaphorina citri psyllid: psy13856

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-

MLSKEWLLVSCDGLLMTLKPTLEIETYTESPLRIGHTLISCDTQAHIGIRSTISLLQGSVYLRRESNKAGALSPKLNRSATSSFHEAAKHLGTVQSSSPACLQPKYFKLTVYSTKLTRILILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMGKTSEQRAIKKELNQSLDKWTPIHSVISTNKMKIHPVMVTG

ccccEEEEEEccEEEcccccccCEEEEECcccccccEEEEECccccEEEEEcccccccEEEEEcEEEEEEECcccccccCEEEEEcccccccCECccccccccccccCEEEEEcccccEEEEEEEccccEEEEEEEcccccccccEEECcccccccccEEEEECccccEEEEEcccccCEEEEEcccccccEEEEEEcccccEEEEECccccEEEEEEcccccEEEEEEcccccccEEEEEEEcEEEEECcccccCECcccccccccEEcc

**SKEWLLVSCDGLLMTLKPTLEIETYTESPLRIGHTLISCDTQAHIGIRSTISLLQGSVYLRRESNKAGALSPKLNRSATSSFHEAAKHLGTVQSS**ACLQPKYFKLTVYSTKLTRILILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMG************NQSLDKWTPIHSVISTNKMKI*PVMV**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein SEC13 homolog	Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles.	confident	Q5XFW8
Protein SEC13 homolog	Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles.	confident	Q3ZCC9
Protein SEC13 homolog	Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles.	confident	P55735

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0006888 [BP]	ER to Golgi vesicle-mediated transport	probable	GO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0005635 [CC]	nuclear envelope	probable	GO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000776 [CC]	kinetochore	probable	GO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0070971 [CC]	endoplasmic reticulum exit site	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044432, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PM7, chain B
Confidence level:very confident
Coverage over the Query: 34-227
View the alignment between query and template
View the model in PyMOL

Template: 3MMY, chain A
Confidence level:confident
Coverage over the Query: 4-236
View the alignment between query and template
View the model in PyMOL