Psyllid ID: psy13856


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MLSKEWLLVSCDGLLMTLKPTLEIETYTESPLRIGHTLISCDTQAHIGIRSTISLLQGSVYLRRESNKAGALSPKLNRSATSSFHEAAKHLGTVQSSSPACLQPKYFKLTVYSTKLTRILILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMGKTSEQRAIKKELNQSLDKWTPIHSVISTNKMKIHPVMVTG
ccccEEEEEEccEEEcccccccEEEEEEEcccccccEEEEEEccccEEEEEcccccccEEEEEcEEEEEEEEcccccccEEEEEEcccccccEEEccccccccccccEEEEEEcccccEEEEEEEccccEEEEEEEcccccccccEEEEcccccccccEEEEEEccccEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEcccccccEEEEEEEcEEEEEEcccccEEEcccccccccEEcc
ccccEEEEEEHHHHHHHccccccEcEEEcccHHccEEEEEEccccEEEEEEEccccEEEEEEEEEccccccccHHHHHcccccccEEEccccccccccccccccccccEEEEEcccccEEEEEEEcccccEEEEEHcccccccHHHHcccccccccccEEEEEccccEEEEEEEcccccEEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEEcccccEEEEEEEcccccccccccccccccccccccccccccccEEEEEccccc
MLSKEWLLVSCDGllmtlkptleietytesplrightliscdtqahigIRSTISLLQGSVYlrresnkagalspklnrsatSSFHEAAKHlgtvqssspaclqpkyfkLTVYSTKLTRILILVRICGGDKWIEETklenhsdwvrdvawapswglskcmiascsqDRKVIIWTSndyvtwtpfimntFDDVVWNVSWSltgdiltvscgdnsvslwKENTDGAWQCITEMGKTSEQRAIKKELNQsldkwtpihsvistnkmkiHPVMVTG
MLSKEWLLVSCDGLLMTLKPTLEIETYTESPLRIGHTLISCDTQAHIGIRSTISLLQGSVYLRRESnkagalspklnrSATSSFHEAAKHLgtvqssspaclQPKYFKLTVYSTKLTRILILVRICGGDKWIEetklenhsdwvrDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMGKTSEQRAIKKELnqsldkwtpihsvistnkmkihpvmvtg
MLSKEWLLVSCDGLLMTLKPTLEIETYTESPLRIGHTLISCDTQAHIGIRSTISLLQGSVYLRRESNKAGALSPKLNRSATSSFHEAAKHLGTVQSSSPACLQPKYFKLTVYSTKLTRILILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMGKTSEQRAIKKELNQSLDKWTPIHSVISTNKMKIHPVMVTG
****EWLLVSCDGLLMTLKPTLEIETYTESPLRIGHTLISCDTQAHIGIRSTISLLQGSVYLR************************************ACLQPKYFKLTVYSTKLTRILILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMG***************LDKWTPIHSVIST************
**SKEWLLVSCDGLLMTLKPTLEIETYTESPLRIGHTLISCDTQAHIGIRSTISLLQGSVYLRRESNKAGALSPKLNRSATSSFHEAAKHLGTVQSS*******KYFKLTVYSTKLTRILILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEM*************NQSLDKWTPIHSVISTNKMKI*PVMV**
MLSKEWLLVSCDGLLMTLKPTLEIETYTESPLRIGHTLISCDTQAHIGIRSTISLLQGSVYLRRESNKAGALSPKLNRSATSSFHEAAKHLGTVQSSSPACLQPKYFKLTVYSTKLTRILILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMGKTSEQRAIKKELNQSLDKWTPIHSVISTNKMKIHPVMVTG
*LSKEWLLVSCDGLLMTLKPTLEIETYTESPLRIGHTLISCDTQAHIGIRSTISLLQGSVYLRRESNKAGALSPKLNRSATSSFHEAAKHLGTVQSSSPACLQPKYFKLTVYSTKLTRILILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMGK****************K**********NKMKI*PV**T*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSKEWLLVSCDGLLMTLKPTLEIETYTESPLRIGHTLISCDTQAHIGIRSTISLLQGSVYLRRESNKAGALSPKLNRSATSSFHEAAKHLGTVQSSSPACLQPKYFKLTVYSTKLTRILILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMGKTSEQRAIKKELNQSLDKWTPIHSVISTNKMKIHPVMVTG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query271 2.2.26 [Sep-21-2011]
P55735322 Protein SEC13 homolog OS= yes N/A 0.490 0.413 0.514 4e-31
Q9D1M0322 Protein SEC13 homolog OS= yes N/A 0.490 0.413 0.514 5e-31
Q5XFW8322 Protein SEC13 homolog OS= yes N/A 0.490 0.413 0.514 6e-31
Q3ZCC9322 Protein SEC13 homolog OS= yes N/A 0.490 0.413 0.507 6e-31
Q54DS8301 Protein transport protein yes N/A 0.623 0.561 0.418 8e-29
Q4PCB8364 Protein transport protein N/A N/A 0.376 0.280 0.448 1e-23
P0CS50339 Protein transport protein yes N/A 0.402 0.321 0.479 2e-23
P0CS51339 Protein transport protein N/A N/A 0.402 0.321 0.479 2e-23
O94319297 Protein transport protein yes N/A 0.494 0.451 0.460 5e-23
Q5AEF2298 Protein transport protein N/A N/A 0.372 0.338 0.519 3e-22
>sp|P55735|SEC13_HUMAN Protein SEC13 homolog OS=Homo sapiens GN=SEC13 PE=1 SV=3 Back     alignment and function desciption
 Score =  135 bits (339), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 91/136 (66%), Gaps = 3/136 (2%)

Query: 99  PACLQPKYFKLTVYSTKLTRILILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKC 158
           P+  +P Y K    S     ++ L +     +W EE KLE HSDWVRDVAWAPS GL   
Sbjct: 171 PSGQKPNYIK-RFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTS 229

Query: 159 MIASCSQDRKVIIWTSNDYV--TWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLW 216
            IASCSQD +V IWT +D    TW+P +++ F+DVVW+VSWS+T +IL VS GDN V+LW
Sbjct: 230 TIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLW 289

Query: 217 KENTDGAWQCITEMGK 232
           KE+ DG W CI+++ K
Sbjct: 290 KESVDGQWVCISDVNK 305




Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles.
Homo sapiens (taxid: 9606)
>sp|Q9D1M0|SEC13_MOUSE Protein SEC13 homolog OS=Mus musculus GN=Sec13 PE=2 SV=3 Back     alignment and function description
>sp|Q5XFW8|SEC13_RAT Protein SEC13 homolog OS=Rattus norvegicus GN=Sec13 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZCC9|SEC13_BOVIN Protein SEC13 homolog OS=Bos taurus GN=SEC13 PE=2 SV=1 Back     alignment and function description
>sp|Q54DS8|SEC13_DICDI Protein transport protein SEC13 OS=Dictyostelium discoideum GN=sec13 PE=3 SV=1 Back     alignment and function description
>sp|Q4PCB8|SEC13_USTMA Protein transport protein SEC13 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEC13 PE=3 SV=1 Back     alignment and function description
>sp|P0CS50|SEC13_CRYNJ Protein transport protein SEC13 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SEC13 PE=3 SV=1 Back     alignment and function description
>sp|P0CS51|SEC13_CRYNB Protein transport protein SEC13 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEC13 PE=3 SV=1 Back     alignment and function description
>sp|O94319|SEC13_SCHPO Protein transport protein sec13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec13 PE=1 SV=1 Back     alignment and function description
>sp|Q5AEF2|SEC13_CANAL Protein transport protein SEC13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC13 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
242017223361 protein transport protein sec13, putativ 0.413 0.310 0.677 2e-40
340713861311 PREDICTED: protein SEC13 homolog [Bombus 0.413 0.360 0.677 6e-40
156540469311 PREDICTED: protein SEC13 homolog [Nasoni 0.413 0.360 0.677 1e-39
383859895311 PREDICTED: protein SEC13 homolog [Megach 0.413 0.360 0.677 1e-39
110756630311 PREDICTED: protein SEC13 homolog [Apis m 0.413 0.360 0.677 2e-39
307201502313 Protein SEC13-like protein [Harpegnathos 0.413 0.357 0.638 3e-39
307177449313 Protein SEC13-like protein [Camponotus f 0.413 0.357 0.644 3e-39
389615099184 protein transport protein sec13, partial 0.387 0.570 0.704 6e-38
357630898313 putative protein transport protein sec13 0.402 0.348 0.678 7e-38
332025688310 Protein SEC13-like protein [Acromyrmex e 0.409 0.358 0.615 3e-37
>gi|242017223|ref|XP_002429091.1| protein transport protein sec13, putative [Pediculus humanus corporis] gi|212513955|gb|EEB16353.1| protein transport protein sec13, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  172 bits (436), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/118 (67%), Positives = 98/118 (83%), Gaps = 6/118 (5%)

Query: 128 GDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNT 187
           GD+WIEE KLE HSDWVRDVAWAPS GL K +IASCSQDR+VIIW+S+D + WTP ++NT
Sbjct: 244 GDRWIEEAKLEVHSDWVRDVAWAPSLGLPKSLIASCSQDRRVIIWSSDDNINWTPTVLNT 303

Query: 188 FDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMGK------TSEQRAI 239
           FDDVVWNVSWSLTG+IL+VS GDN VSLW+EN +G W CI+E+ K      +++QRA+
Sbjct: 304 FDDVVWNVSWSLTGNILSVSGGDNKVSLWRENNEGQWMCISEVNKGQGTVSSNDQRAV 361




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340713861|ref|XP_003395453.1| PREDICTED: protein SEC13 homolog [Bombus terrestris] gi|350409642|ref|XP_003488802.1| PREDICTED: protein SEC13 homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|156540469|ref|XP_001599879.1| PREDICTED: protein SEC13 homolog [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383859895|ref|XP_003705427.1| PREDICTED: protein SEC13 homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|110756630|ref|XP_393516.3| PREDICTED: protein SEC13 homolog [Apis mellifera] gi|380024897|ref|XP_003696225.1| PREDICTED: protein SEC13 homolog [Apis florea] Back     alignment and taxonomy information
>gi|307201502|gb|EFN81265.1| Protein SEC13-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307177449|gb|EFN66576.1| Protein SEC13-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|389615099|dbj|BAM20542.1| protein transport protein sec13, partial [Papilio polytes] Back     alignment and taxonomy information
>gi|357630898|gb|EHJ78717.1| putative protein transport protein sec13 [Danaus plexippus] Back     alignment and taxonomy information
>gi|332025688|gb|EGI65847.1| Protein SEC13-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
FB|FBgn0024509386 Sec13 "Sec13 ortholog (S. cere 0.354 0.248 0.628 1.1e-32
UNIPROTKB|F1PDM3322 SEC13 "Uncharacterized protein 0.490 0.413 0.514 1.4e-32
UNIPROTKB|P55735322 SEC13 "Protein SEC13 homolog" 0.490 0.413 0.514 1.4e-32
ZFIN|ZDB-GENE-040426-2649320 sec13 "SEC13 homolog (S. cerev 0.487 0.412 0.522 1.8e-32
UNIPROTKB|Q3ZCC9322 SEC13 "Protein SEC13 homolog" 0.490 0.413 0.507 1.8e-32
MGI|MGI:99832322 Sec13 "SEC13 homolog (S. cerev 0.490 0.413 0.514 2.9e-32
RGD|1359555322 Sec13 "SEC13 homolog (S. cerev 0.490 0.413 0.514 2.9e-32
UNIPROTKB|E1BVC4320 SEC13 "Uncharacterized protein 0.380 0.321 0.6 3.7e-32
DICTYBASE|DDB_G0292052301 sec13 "putative transport prot 0.715 0.644 0.388 6.9e-31
POMBASE|SPBC215.15297 sec13 "COPII-coated vesicle co 0.490 0.447 0.471 5.2e-26
FB|FBgn0024509 Sec13 "Sec13 ortholog (S. cerevisiae)" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 357 (130.7 bits), Expect = 1.1e-32, P = 1.1e-32
 Identities = 61/97 (62%), Positives = 78/97 (80%)

Query:   129 DKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSN-DYVTWTPFIMNT 187
             D+W+EE +LE HSDWVRDVAWAPS GL +  IA+ SQDR VI+W+SN D   WT  +++T
Sbjct:   230 DRWVEEHRLEAHSDWVRDVAWAPSIGLPRSQIATASQDRHVIVWSSNADLSEWTSTVLHT 289

Query:   188 FDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAW 224
             FDD VW++SWS TG+IL V+ GDN+V+LWKENT+G W
Sbjct:   290 FDDAVWSISWSTTGNILAVTGGDNNVTLWKENTEGQW 326


GO:0006900 "membrane budding" evidence=ISS
GO:0008363 "larval chitin-based cuticle development" evidence=IMP
GO:0035293 "chitin-based larval cuticle pattern formation" evidence=IMP
GO:0010629 "negative regulation of gene expression" evidence=IDA
GO:0031080 "nuclear pore outer ring" evidence=ISS
GO:0007184 "SMAD protein import into nucleus" evidence=IMP
GO:0006607 "NLS-bearing substrate import into nucleus" evidence=IMP
UNIPROTKB|F1PDM3 SEC13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P55735 SEC13 "Protein SEC13 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2649 sec13 "SEC13 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCC9 SEC13 "Protein SEC13 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:99832 Sec13 "SEC13 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359555 Sec13 "SEC13 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVC4 SEC13 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292052 sec13 "putative transport protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPBC215.15 sec13 "COPII-coated vesicle component Sec13" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3ZCC9SEC13_BOVINNo assigned EC number0.50730.49070.4130yesN/A
Q5XFW8SEC13_RATNo assigned EC number0.51470.49070.4130yesN/A
Q9D1M0SEC13_MOUSENo assigned EC number0.51470.49070.4130yesN/A
P55735SEC13_HUMANNo assigned EC number0.51470.49070.4130yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-06
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-06
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-05
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 5e-05
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 1e-04
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 4e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-04
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-04
smart0032040 smart00320, WD40, WD40 repeats 0.001
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 0.003
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 48.5 bits (116), Expect = 1e-06
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 12/83 (14%)

Query: 137 LENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTPFIMNTF---DDVVW 193
           L  H+DWV  VA++P        +AS SQD  + +W   D  T     + T       V 
Sbjct: 131 LRGHTDWVNSVAFSPD----GTFVASSSQDGTIKLW---DLRTGKC--VATLTGHTGEVN 181

Query: 194 NVSWSLTGDILTVSCGDNSVSLW 216
           +V++S  G+ L  S  D ++ LW
Sbjct: 182 SVAFSPDGEKLLSSSSDGTIKLW 204


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 271
KOG0271|consensus480 99.97
KOG0272|consensus459 99.97
KOG0272|consensus459 99.97
KOG0263|consensus707 99.96
KOG0271|consensus480 99.96
KOG0279|consensus315 99.95
KOG0645|consensus312 99.95
KOG0295|consensus406 99.95
KOG0263|consensus707 99.95
KOG0315|consensus311 99.95
KOG0286|consensus343 99.95
KOG0291|consensus 893 99.95
KOG0279|consensus315 99.94
KOG0273|consensus524 99.94
KOG0266|consensus456 99.93
KOG0285|consensus 460 99.93
KOG0284|consensus 464 99.93
KOG0645|consensus312 99.93
KOG0273|consensus524 99.93
KOG0266|consensus456 99.93
KOG0284|consensus464 99.92
KOG0319|consensus 775 99.92
KOG0265|consensus338 99.92
KOG1332|consensus299 99.92
KOG0286|consensus343 99.92
KOG0276|consensus 794 99.92
KOG0281|consensus499 99.91
KOG0295|consensus406 99.91
KOG0313|consensus423 99.91
KOG0275|consensus508 99.91
KOG0277|consensus311 99.91
KOG0276|consensus 794 99.9
KOG0283|consensus 712 99.9
PTZ00421 493 coronin; Provisional 99.9
KOG2445|consensus361 99.9
KOG0277|consensus311 99.9
KOG0318|consensus 603 99.9
KOG0293|consensus519 99.9
KOG0319|consensus 775 99.9
KOG0315|consensus311 99.9
KOG0306|consensus 888 99.89
KOG0282|consensus503 99.89
KOG0291|consensus 893 99.89
KOG0643|consensus327 99.89
KOG0281|consensus499 99.89
PTZ00421 493 coronin; Provisional 99.89
KOG1407|consensus313 99.89
KOG0640|consensus430 99.89
KOG0278|consensus334 99.89
KOG0292|consensus 1202 99.89
KOG0973|consensus 942 99.88
PTZ00420 568 coronin; Provisional 99.88
KOG0269|consensus 839 99.88
KOG0316|consensus307 99.88
KOG0264|consensus422 99.88
KOG1446|consensus311 99.88
KOG1332|consensus299 99.87
KOG0292|consensus 1202 99.87
PLN00181793 protein SPA1-RELATED; Provisional 99.87
KOG0318|consensus603 99.87
KOG0306|consensus 888 99.86
KOG0310|consensus 487 99.86
KOG0282|consensus503 99.86
PTZ00420 568 coronin; Provisional 99.86
KOG0316|consensus307 99.86
KOG4283|consensus397 99.86
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.86
KOG0296|consensus 399 99.86
KOG0265|consensus338 99.85
KOG0308|consensus 735 99.85
KOG0296|consensus399 99.85
KOG0289|consensus506 99.85
KOG0285|consensus460 99.85
KOG0274|consensus537 99.85
KOG0313|consensus423 99.84
KOG0973|consensus 942 99.84
KOG0305|consensus484 99.84
KOG0302|consensus440 99.84
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.84
PLN00181793 protein SPA1-RELATED; Provisional 99.83
KOG0289|consensus506 99.83
KOG0772|consensus 641 99.83
KOG0294|consensus362 99.83
KOG0646|consensus 476 99.82
KOG0283|consensus712 99.82
KOG0288|consensus459 99.82
KOG0264|consensus422 99.82
KOG0301|consensus 745 99.82
KOG0269|consensus 839 99.81
KOG0274|consensus537 99.81
KOG0268|consensus433 99.81
KOG0302|consensus440 99.81
KOG0310|consensus 487 99.81
KOG0639|consensus705 99.81
KOG0641|consensus350 99.8
KOG0299|consensus479 99.8
KOG0308|consensus 735 99.8
KOG0643|consensus327 99.8
KOG0641|consensus350 99.79
KOG0267|consensus 825 99.78
KOG0303|consensus 472 99.78
KOG0301|consensus 745 99.77
KOG1273|consensus 405 99.77
KOG0305|consensus484 99.76
KOG0275|consensus508 99.76
KOG0294|consensus 362 99.76
KOG0647|consensus347 99.76
KOG0270|consensus463 99.76
KOG1408|consensus 1080 99.76
KOG2096|consensus420 99.75
KOG0639|consensus705 99.75
KOG0647|consensus 347 99.74
KOG4328|consensus498 99.74
KOG1446|consensus311 99.74
KOG1007|consensus370 99.74
KOG0293|consensus 519 99.73
KOG0270|consensus463 99.73
KOG0268|consensus433 99.73
KOG1539|consensus 910 99.73
KOG1009|consensus 434 99.72
KOG1036|consensus323 99.72
KOG4378|consensus 673 99.72
KOG1274|consensus 933 99.71
KOG0300|consensus481 99.71
KOG0300|consensus481 99.71
KOG0303|consensus 472 99.71
KOG2919|consensus406 99.7
KOG0267|consensus 825 99.7
KOG1407|consensus313 99.7
KOG1408|consensus 1080 99.7
KOG0771|consensus398 99.7
KOG1063|consensus764 99.69
KOG0278|consensus 334 99.69
KOG1445|consensus 1012 99.69
KOG1445|consensus 1012 99.68
KOG0288|consensus459 99.67
KOG2096|consensus420 99.67
KOG0299|consensus479 99.66
KOG0646|consensus476 99.66
KOG0640|consensus430 99.66
KOG0772|consensus 641 99.65
KOG0290|consensus364 99.64
KOG2055|consensus514 99.64
KOG1034|consensus385 99.63
KOG1034|consensus 385 99.63
KOG0307|consensus 1049 99.63
KOG1188|consensus376 99.63
KOG1274|consensus 933 99.62
KOG1007|consensus370 99.61
KOG1036|consensus 323 99.61
KOG0321|consensus 720 99.61
KOG0642|consensus577 99.6
KOG2048|consensus 691 99.6
KOG1063|consensus764 99.6
KOG2919|consensus406 99.59
KOG1524|consensus 737 99.59
KOG2106|consensus626 99.58
KOG0321|consensus 720 99.58
KOG1009|consensus 434 99.57
KOG1538|consensus 1081 99.57
KOG1523|consensus 361 99.57
KOG2445|consensus 361 99.57
KOG0322|consensus323 99.56
KOG4283|consensus397 99.56
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.55
KOG2106|consensus626 99.55
KOG2055|consensus514 99.55
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.55
KOG0307|consensus 1049 99.54
KOG0649|consensus325 99.54
KOG2111|consensus346 99.51
KOG2394|consensus 636 99.51
KOG2110|consensus391 99.48
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.48
KOG1538|consensus 1081 99.45
KOG2048|consensus 691 99.45
KOG2394|consensus 636 99.44
KOG0642|consensus577 99.43
KOG1524|consensus 737 99.43
KOG0290|consensus364 99.4
KOG0644|consensus 1113 99.39
KOG1587|consensus555 99.39
KOG1310|consensus 758 99.38
KOG4378|consensus 673 99.37
KOG0649|consensus325 99.37
KOG0650|consensus733 99.36
KOG1272|consensus 545 99.36
KOG1273|consensus 405 99.34
COG2319466 FOG: WD40 repeat [General function prediction only 99.34
KOG0650|consensus733 99.34
KOG1310|consensus 758 99.32
KOG1517|consensus1387 99.32
KOG0644|consensus 1113 99.32
KOG4328|consensus498 99.32
KOG1587|consensus555 99.32
KOG1188|consensus376 99.3
COG2319 466 FOG: WD40 repeat [General function prediction only 99.29
KOG0974|consensus 967 99.29
KOG4227|consensus 609 99.29
KOG1240|consensus 1431 99.28
PRK01742429 tolB translocation protein TolB; Provisional 99.27
KOG1539|consensus 910 99.24
KOG1523|consensus 361 99.23
KOG3881|consensus412 99.23
KOG1963|consensus 792 99.22
KOG1517|consensus1387 99.19
PRK11028330 6-phosphogluconolactonase; Provisional 99.19
PRK01742429 tolB translocation protein TolB; Provisional 99.17
KOG1963|consensus 792 99.16
KOG0280|consensus339 99.15
KOG0280|consensus339 99.14
KOG0771|consensus398 99.13
PRK05137435 tolB translocation protein TolB; Provisional 99.11
PRK11028330 6-phosphogluconolactonase; Provisional 99.11
KOG0974|consensus 967 99.09
PRK03629429 tolB translocation protein TolB; Provisional 99.09
KOG1409|consensus404 99.08
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.07
KOG1272|consensus 545 99.07
KOG4227|consensus 609 99.05
PRK04922433 tolB translocation protein TolB; Provisional 99.04
PRK02889427 tolB translocation protein TolB; Provisional 99.04
KOG2321|consensus 703 99.03
KOG2110|consensus 391 99.03
KOG2139|consensus 445 99.03
PRK05137435 tolB translocation protein TolB; Provisional 98.99
KOG2111|consensus346 98.99
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.99
KOG0322|consensus323 98.98
KOG3914|consensus 390 98.95
PRK04922433 tolB translocation protein TolB; Provisional 98.95
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.93
PRK03629429 tolB translocation protein TolB; Provisional 98.93
KOG1240|consensus 1431 98.93
KOG1064|consensus2439 98.93
KOG2139|consensus445 98.92
KOG4714|consensus319 98.92
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.91
KOG4497|consensus 447 98.9
KOG4547|consensus 541 98.87
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.85
KOG1334|consensus 559 98.85
KOG1409|consensus404 98.84
PRK01029428 tolB translocation protein TolB; Provisional 98.82
KOG1334|consensus559 98.77
KOG2321|consensus 703 98.76
KOG4547|consensus 541 98.72
PRK02889427 tolB translocation protein TolB; Provisional 98.71
PRK00178430 tolB translocation protein TolB; Provisional 98.7
KOG2695|consensus425 98.68
KOG4532|consensus344 98.66
PRK04792448 tolB translocation protein TolB; Provisional 98.64
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.63
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.62
PRK00178430 tolB translocation protein TolB; Provisional 98.62
KOG4497|consensus 447 98.6
KOG1354|consensus 433 98.57
KOG4190|consensus1034 98.57
KOG3881|consensus412 98.54
PRK04792448 tolB translocation protein TolB; Provisional 98.54
KOG1354|consensus433 98.52
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.52
KOG0882|consensus 558 98.52
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.49
KOG3914|consensus390 98.48
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.47
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.44
KOG1275|consensus 1118 98.43
KOG0309|consensus 1081 98.42
COG4946 668 Uncharacterized protein related to the periplasmic 98.41
KOG4714|consensus319 98.4
KOG2041|consensus 1189 98.39
KOG0309|consensus 1081 98.34
KOG2315|consensus 566 98.32
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.3
KOG2066|consensus 846 98.26
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.23
PRK04043419 tolB translocation protein TolB; Provisional 98.19
KOG1064|consensus2439 98.19
KOG2041|consensus 1189 98.16
KOG4190|consensus 1034 98.16
COG4946668 Uncharacterized protein related to the periplasmic 98.15
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.14
PRK01029428 tolB translocation protein TolB; Provisional 98.09
KOG2066|consensus 846 98.08
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.08
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.03
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.97
KOG2315|consensus 566 97.94
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.84
KOG2314|consensus 698 97.83
KOG4532|consensus344 97.82
KOG1645|consensus463 97.81
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.8
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.79
KOG2695|consensus425 97.78
KOG4640|consensus 665 97.75
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.72
KOG1912|consensus 1062 97.67
KOG2114|consensus 933 97.6
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.59
KOG1645|consensus 463 97.58
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.56
PRK04043419 tolB translocation protein TolB; Provisional 97.54
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.49
KOG3621|consensus 726 97.45
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.32
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.28
KOG2314|consensus698 97.23
KOG1920|consensus 1265 97.17
KOG4640|consensus 665 97.17
KOG3617|consensus 1416 97.14
KOG1920|consensus 1265 97.14
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.06
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.04
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.04
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.02
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.01
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.97
KOG1912|consensus 1062 96.96
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.95
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.9
KOG1008|consensus 783 96.85
KOG0882|consensus 558 96.79
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.74
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.68
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.67
KOG1275|consensus 1118 96.46
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.46
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.45
KOG1832|consensus 1516 96.41
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.31
KOG2114|consensus 933 96.22
KOG1008|consensus 783 96.2
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.14
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.12
KOG2444|consensus238 96.12
KOG2395|consensus644 96.04
KOG3621|consensus 726 95.89
KOG2444|consensus238 95.86
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.81
KOG1832|consensus 1516 95.76
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.68
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.57
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 95.57
KOG4649|consensus 354 95.5
PHA02713557 hypothetical protein; Provisional 95.48
PRK02888 635 nitrous-oxide reductase; Validated 95.23
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.04
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 94.89
PHA02713557 hypothetical protein; Provisional 94.84
KOG2079|consensus 1206 94.74
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.66
KOG3617|consensus 1416 94.63
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 94.54
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 94.23
KOG2079|consensus 1206 94.16
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 93.81
PRK02888 635 nitrous-oxide reductase; Validated 93.65
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.22
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 93.09
KOG3630|consensus 1405 92.97
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 92.91
PRK13616591 lipoprotein LpqB; Provisional 92.82
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 92.78
KOG2395|consensus644 92.46
KOG4441|consensus571 92.34
KOG4441|consensus571 92.19
PHA03098534 kelch-like protein; Provisional 92.16
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 91.84
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 91.52
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 91.48
PRK13616591 lipoprotein LpqB; Provisional 91.32
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 90.91
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 90.49
KOG4649|consensus354 90.2
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 89.35
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 88.99
PF06977 248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 88.72
PLN00033398 photosystem II stability/assembly factor; Provisio 88.34
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 88.27
COG3490366 Uncharacterized protein conserved in bacteria [Fun 87.61
KOG3630|consensus 1405 87.6
PHA03098534 kelch-like protein; Provisional 87.46
COG5167776 VID27 Protein involved in vacuole import and degra 87.04
COG3386307 Gluconolactonase [Carbohydrate transport and metab 86.9
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 86.75
KOG1897|consensus 1096 86.7
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 86.62
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 86.19
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 86.13
KOG1916|consensus 1283 85.09
PHA02790480 Kelch-like protein; Provisional 84.91
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 84.72
COG3490366 Uncharacterized protein conserved in bacteria [Fun 84.59
KOG1916|consensus 1283 84.39
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 84.05
PF14727 418 PHTB1_N: PTHB1 N-terminus 83.56
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 83.28
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 83.27
COG4590 733 ABC-type uncharacterized transport system, permeas 83.11
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 82.91
PHA02790480 Kelch-like protein; Provisional 82.62
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 81.87
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 81.22
>KOG0271|consensus Back     alignment and domain information
Probab=99.97  E-value=1.6e-30  Score=204.49  Aligned_cols=202  Identities=19%  Similarity=0.190  Sum_probs=159.4

Q ss_pred             cceecccCCCCCCCEEEEccCCCeEEeccc-----eeeeccccccccccceEEEEcCCCCeEEEEeCCCcEEEEEeecCC
Q psy13856         23 EIETYTESPLRIGHTLISCDTQAHIGIRST-----ISLLQGSVYLRRESNKAGALSPKLNRSATSSFHEAAKHLGTVQSS   97 (271)
Q Consensus        23 ~~~~~~~~~~~~g~~l~s~s~d~~i~lwd~-----~~~~~~h~~~~~~~i~~~~~s~~~~~l~s~s~d~~i~~~d~~~~~   97 (271)
                      +-.+.+....|+|..|++|+.|.++|+||+     +.+.++|..+    |.+++|+|||+.||+|+.||+|++||-   +
T Consensus       115 ~e~Vl~~~fsp~g~~l~tGsGD~TvR~WD~~TeTp~~t~KgH~~W----VlcvawsPDgk~iASG~~dg~I~lwdp---k  187 (480)
T KOG0271|consen  115 GEAVLSVQFSPTGSRLVTGSGDTTVRLWDLDTETPLFTCKGHKNW----VLCVAWSPDGKKIASGSKDGSIRLWDP---K  187 (480)
T ss_pred             CCcEEEEEecCCCceEEecCCCceEEeeccCCCCcceeecCCccE----EEEEEECCCcchhhccccCCeEEEecC---C
Confidence            334455666679999999999999999999     7889999999    999999999999999999999999997   6


Q ss_pred             CCceeecc--ceeeEEEe---------eccceee-----eEEEEeeCCceEEeEEecCCCcceEEEEEccCCCCCCcEEE
Q psy13856         98 SPACLQPK--YFKLTVYS---------TKLTRIL-----ILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIA  161 (271)
Q Consensus        98 ~~~~~~~~--~~~~~~~~---------~~~~~l~-----~~v~i~~~~~~~~~~~~~~h~~~v~~v~~~p~~~~~~~~l~  161 (271)
                      +++++-..  .+...+.+         ...++++     +.++|++...-.++..+.+|+.+|+|++|--     ..+|+
T Consensus       188 tg~~~g~~l~gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~lsgHT~~VTCvrwGG-----~gliy  262 (480)
T KOG0271|consen  188 TGQQIGRALRGHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRTLSGHTASVTCVRWGG-----EGLIY  262 (480)
T ss_pred             CCCcccccccCcccceeEEeecccccCCCccceecccCCCCEEEEEccCceEEEEeccCccceEEEEEcC-----CceEE
Confidence            66555322  23222222         1255676     8899933222278899999999999999974     47999


Q ss_pred             EEeCCCeEEEEEcCCCce--------------------------------------------------------------
Q psy13856        162 SCSQDRKVIIWTSNDYVT--------------------------------------------------------------  179 (271)
Q Consensus       162 s~~~dg~i~iwd~~~~~~--------------------------------------------------------------  179 (271)
                      +|+.|++|++|+...+.+                                                              
T Consensus       263 SgS~DrtIkvw~a~dG~~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVSg  342 (480)
T KOG0271|consen  263 SGSQDRTIKVWRALDGKLCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVSG  342 (480)
T ss_pred             ecCCCceEEEEEccchhHHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEEe
Confidence            999999999999865210                                                              


Q ss_pred             --------e-------eeeeeccCCCCeEEEEEecCCCEEEEEECCCcEEEEEeCCCCceeEEEEecccchhhhh
Q psy13856        180 --------W-------TPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMGKTSEQRAI  239 (271)
Q Consensus       180 --------~-------~~~~~~~h~~~v~~v~~~~~g~~l~s~s~D~~v~iw~~~~~~~~~~~~~~~~~~~~~~~  239 (271)
                              |       ++..+.+|...|+.+.|+||++++|++|.|..|++|+-+++   +.+.++.+|-..+-+
T Consensus       343 sDd~tlflW~p~~~kkpi~rmtgHq~lVn~V~fSPd~r~IASaSFDkSVkLW~g~tG---k~lasfRGHv~~VYq  414 (480)
T KOG0271|consen  343 SDDFTLFLWNPFKSKKPITRMTGHQALVNHVSFSPDGRYIASASFDKSVKLWDGRTG---KFLASFRGHVAAVYQ  414 (480)
T ss_pred             cCCceEEEecccccccchhhhhchhhheeeEEECCCccEEEEeecccceeeeeCCCc---chhhhhhhccceeEE
Confidence                    1       12245688899999999999999999999999999999988   666777776655443



>KOG0272|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
3bg0_A316 Architecture Of A Coat For The Nuclear Pore Membran 4e-32
3jro_A 753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 2e-21
3jrp_A379 Sec13 With Nup145c (Aa109-179) Insertion Blade Leng 5e-21
2pm6_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 1e-20
2pm9_B297 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 1e-20
2pm7_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 2e-20
3fm0_A 345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 1e-05
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 3e-05
>pdb|3BG0|A Chain A, Architecture Of A Coat For The Nuclear Pore Membrane Length = 316 Back     alignment and structure

Iteration: 1

Score = 134 bits (338), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 70/136 (51%), Positives = 91/136 (66%), Gaps = 3/136 (2%) Query: 99 PACLQPKYFKLTVYSTKLTRILILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKC 158 P+ +P Y K S ++ L + +W EE KLE HSDWVRDVAWAPS GL Sbjct: 171 PSGQKPNYIK-RFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTS 229 Query: 159 MIASCSQDRKVIIWTSNDYV--TWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLW 216 IASCSQD +V IWT +D TW+P +++ F+DVVW+VSWS+T +IL VS GDN V+LW Sbjct: 230 TIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLW 289 Query: 217 KENTDGAWQCITEMGK 232 KE+ DG W CI+++ K Sbjct: 290 KESVDGQWVCISDVNK 305
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|3JRP|A Chain A, Sec13 With Nup145c (Aa109-179) Insertion Blade Length = 379 Back     alignment and structure
>pdb|2PM6|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Native Version Length = 297 Back     alignment and structure
>pdb|2PM9|B Chain B, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 297 Back     alignment and structure
>pdb|2PM7|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Selenomethionine Version Length = 297 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.97
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.97
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.96
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.96
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.96
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.96
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.96
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.96
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.96
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.96
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.96
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.96
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.96
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.96
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.96
2pm7_B297 Protein transport protein SEC13, protein transport 99.96
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.95
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.95
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.95
2pm7_B297 Protein transport protein SEC13, protein transport 99.95
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.95
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.95
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.95
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.95
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.95
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.95
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.95
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.95
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.94
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.94
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.94
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.94
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.94
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.94
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.94
3jrp_A379 Fusion protein of protein transport protein SEC13 99.94
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.94
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.94
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.94
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.93
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.93
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.93
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.93
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.93
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.93
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.93
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.92
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.92
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.92
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.92
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.92
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.92
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.92
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.92
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.92
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.92
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.91
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.91
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.91
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.91
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.91
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.91
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.91
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.91
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.91
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.91
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.9
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.9
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.9
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.9
3jro_A 753 Fusion protein of protein transport protein SEC13 99.9
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.9
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.9
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.9
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.9
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.9
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.9
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.9
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.9
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.9
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.9
3jro_A 753 Fusion protein of protein transport protein SEC13 99.9
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.9
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.9
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.89
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.89
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.89
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.89
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.89
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.89
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.89
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.89
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.89
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.89
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.89
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.89
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.89
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.89
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.89
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.89
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.88
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.88
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.88
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.88
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.88
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.88
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.88
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.88
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.88
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.88
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.88
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.88
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.88
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.88
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.87
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.87
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.87
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.86
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.85
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.83
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.82
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.79
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.79
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.79
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.77
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.76
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.76
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.76
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.74
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.67
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.65
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.65
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.62
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.62
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.61
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.6
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.59
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.58
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.58
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.57
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.57
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.57
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.54
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.53
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.51
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.5
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.5
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.49
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.49
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.49
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.48
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.47
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.47
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.45
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.44
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.43
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.38
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.38
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.37
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.37
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.37
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.34
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.33
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.29
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.25
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.2
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.18
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.16
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.14
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.14
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.13
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.13
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.12
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.1
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.09
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.09
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.07
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.07
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.04
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.02
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.99
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.98
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.93
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.92
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.92
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.91
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.87
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.86
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.85
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.85
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.84
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.83
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.78
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.76
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.72
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.63
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.6
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.59
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.58
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.55
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.53
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.53
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.52
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.5
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.49
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.47
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.46
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.4
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.39
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.39
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.32
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.3
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.27
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.24
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.07
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.07
2qe8_A343 Uncharacterized protein; structural genomics, join 98.06
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.03
2ece_A462 462AA long hypothetical selenium-binding protein; 97.98
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.98
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.95
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 97.83
2ece_A 462 462AA long hypothetical selenium-binding protein; 97.71
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.65
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.58
2qe8_A 343 Uncharacterized protein; structural genomics, join 97.42
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.41
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 97.3
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.28
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.28
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.23
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 97.19
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.18
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.13
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 97.1
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 97.1
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.0
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.98
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.93
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.93
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.9
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.87
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.78
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 96.78
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.76
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.7
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.57
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.48
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.43
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.42
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.39
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.36
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.28
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 96.17
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.14
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.99
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 95.87
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.81
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 95.8
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.73
3kya_A 496 Putative phosphatase; structural genomics, joint c 95.63
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.62
3v65_B386 Low-density lipoprotein receptor-related protein; 95.59
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.58
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.28
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.26
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.17
3v65_B386 Low-density lipoprotein receptor-related protein; 95.11
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 94.97
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 94.74
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 94.55
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.29
2p4o_A 306 Hypothetical protein; putative lactonase, structur 94.12
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 94.01
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 93.93
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 93.72
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 93.71
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 93.66
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 93.51
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 93.24
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 93.07
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 93.03
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 92.84
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 92.72
3p5b_L400 Low density lipoprotein receptor variant; B-propel 92.35
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 92.15
3p5b_L400 Low density lipoprotein receptor variant; B-propel 92.15
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 92.06
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 91.89
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 91.7
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 91.6
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 91.59
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 91.55
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 91.5
4a2l_A 795 BT_4663, two-component system sensor histidine kin 91.09
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 91.02
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 90.96
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 90.92
4a2l_A 795 BT_4663, two-component system sensor histidine kin 90.91
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 90.88
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 90.78
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 90.7
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 89.77
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 89.25
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 89.13
3v9f_A 781 Two-component system sensor histidine kinase/RESP 88.63
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 88.56
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 86.98
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 86.89
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 86.36
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 86.26
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 86.08
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 85.74
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 82.52
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 81.55
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 80.98
3v9f_A 781 Two-component system sensor histidine kinase/RESP 80.75
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=1.6e-28  Score=201.79  Aligned_cols=195  Identities=17%  Similarity=0.169  Sum_probs=163.9

Q ss_pred             ecccCCCCCCCEEEEccCCCeEEeccc-----eeeeccccccccccceEEEEcCCCCeEEEEeCCCcEEEEEeecCCCCc
Q psy13856         26 TYTESPLRIGHTLISCDTQAHIGIRST-----ISLLQGSVYLRRESNKAGALSPKLNRSATSSFHEAAKHLGTVQSSSPA  100 (271)
Q Consensus        26 ~~~~~~~~~g~~l~s~s~d~~i~lwd~-----~~~~~~h~~~~~~~i~~~~~s~~~~~l~s~s~d~~i~~~d~~~~~~~~  100 (271)
                      +......+++.++++++.|++|++||+     +..+..|...    +.+++|+|++++|++++.|+.+++|+.   .++.
T Consensus        83 v~~~~~~~~~~~l~s~s~D~~i~lWd~~~~~~~~~~~~~~~~----~~~~~~spdg~~l~~g~~dg~v~i~~~---~~~~  155 (321)
T 3ow8_A           83 VVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVD----AWTLAFSPDSQYLATGTHVGKVNIFGV---ESGK  155 (321)
T ss_dssp             EEEEEECSSSSEEEEEETTSEEEEEETTTTEEEEEEECCTTC----CCCEEECTTSSEEEEECTTSEEEEEET---TTCS
T ss_pred             EEEEEECCCCCEEEEEeCCCcEEEEECCCCCEEEEEeCCCcc----EEEEEECCCCCEEEEEcCCCcEEEEEc---CCCc
Confidence            344445578999999999999999998     5667788877    899999999999999999999999998   5555


Q ss_pred             eeecc-----ceeeEEEeeccceee-----eEEEEeeCCceEEeEEecCCCcceEEEEEccCCCCCCcEEEEEeCCCeEE
Q psy13856        101 CLQPK-----YFKLTVYSTKLTRIL-----ILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVI  170 (271)
Q Consensus       101 ~~~~~-----~~~~~~~~~~~~~l~-----~~v~i~~~~~~~~~~~~~~h~~~v~~v~~~p~~~~~~~~l~s~~~dg~i~  170 (271)
                      .....     ......+++++++++     +.|++.+....+.+..+.+|...|.+++|+|    ++.+|++|+.|+.|+
T Consensus       156 ~~~~~~~~~~~v~~~~~spdg~~lasg~~dg~i~iwd~~~~~~~~~~~~h~~~v~~l~~sp----d~~~l~s~s~dg~i~  231 (321)
T 3ow8_A          156 KEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSP----DSQLLVTASDDGYIK  231 (321)
T ss_dssp             EEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCCCEEEECT----TSCEEEEECTTSCEE
T ss_pred             eeEEecCCCceEEEEEECCCCCEEEEEcCCCeEEEEECCCCcEEEEEcccCCceeEEEEcC----CCCEEEEEcCCCeEE
Confidence            44332     224556777788887     7788832222278888999999999999999    699999999999999


Q ss_pred             EEEcCCCceeeeeeeccCCCCeEEEEEecCCCEEEEEECCCcEEEEEeCCCCceeEEEEecccchh
Q psy13856        171 IWTSNDYVTWTPFIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMGKTSEQ  236 (271)
Q Consensus       171 iwd~~~~~~~~~~~~~~h~~~v~~v~~~~~g~~l~s~s~D~~v~iw~~~~~~~~~~~~~~~~~~~~  236 (271)
                      +||++....  ...+.+|...|.+++|+|++.+|++++.|++|++||++++   +++.++.+|...
T Consensus       232 iwd~~~~~~--~~~~~~h~~~v~~~~~sp~~~~l~s~s~D~~v~iwd~~~~---~~~~~~~~h~~~  292 (321)
T 3ow8_A          232 IYDVQHANL--AGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTR---TCVHTFFDHQDQ  292 (321)
T ss_dssp             EEETTTCCE--EEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTT---EEEEEECCCSSC
T ss_pred             EEECCCcce--eEEEcCCCCceEEEEECCCCCEEEEEeCCCcEEEEeCCCC---EEEEEEcCCCCc
Confidence            999998876  6788899999999999999999999999999999999877   788888777654



>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 271
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-08
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-07
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-06
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-04
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.001
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-04
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.001
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.002
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 50.5 bits (119), Expect = 6e-08
 Identities = 19/96 (19%), Positives = 38/96 (39%), Gaps = 8/96 (8%)

Query: 123 VRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVIIWTSNDYVTWTP 182
           +++      +    L  H +WVR V +          I SC+ D+ + +W   DY     
Sbjct: 229 IKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKF----ILSCADDKTLRVW---DYKNKRC 281

Query: 183 F-IMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWK 217
              +N  +  V ++ +  T   +     D +V +W+
Sbjct: 282 MKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWE 317


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.95
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.94
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.93
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.93
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.93
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.92
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.92
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.92
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.92
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.92
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.91
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.9
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.9
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.89
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.88
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.87
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.87
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.87
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.86
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.86
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.85
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.84
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.8
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.79
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.78
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.76
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.71
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.71
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.64
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.64
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.6
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.57
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.56
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.52
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.44
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.41
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.31
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.29
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.2
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.05
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.02
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.0
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 98.89
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.75
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.62
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.49
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.46
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.37
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.28
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.15
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.1
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.06
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.03
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.91
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.89
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 97.81
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.64
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.61
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.56
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.53
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.53
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.33
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.07
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.82
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.26
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 95.12
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 94.6
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 92.97
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 92.57
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 92.32
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 91.58
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 88.33
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 81.33
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Probab=99.95  E-value=5.5e-26  Score=183.91  Aligned_cols=191  Identities=14%  Similarity=0.163  Sum_probs=151.8

Q ss_pred             CCCCCCEEEEccCCCeEEeccc-------eeeeccccccccccceEEEEcCCCCeEEEEeC--CCcEEEEEeecCCCCce
Q psy13856         31 PLRIGHTLISCDTQAHIGIRST-------ISLLQGSVYLRRESNKAGALSPKLNRSATSSF--HEAAKHLGTVQSSSPAC  101 (271)
Q Consensus        31 ~~~~g~~l~s~s~d~~i~lwd~-------~~~~~~h~~~~~~~i~~~~~s~~~~~l~s~s~--d~~i~~~d~~~~~~~~~  101 (271)
                      ..|+|++||+|+.||+|++||+       ...+..|...    |.+++|+|+++++++++.  +..+++|+.   ++++.
T Consensus        66 ~sp~g~~latg~~dg~i~iwd~~~~~~~~~~~~~~~~~~----v~~v~~s~d~~~l~~~~~~~~~~~~v~~~---~~~~~  138 (311)
T d1nr0a1          66 TSPSGYYCASGDVHGNVRIWDTTQTTHILKTTIPVFSGP----VKDISWDSESKRIAAVGEGRERFGHVFLF---DTGTS  138 (311)
T ss_dssp             ECTTSSEEEEEETTSEEEEEESSSTTCCEEEEEECSSSC----EEEEEECTTSCEEEEEECCSSCSEEEEET---TTCCB
T ss_pred             EeCCCCeEeccccCceEeeeeeeccccccccccccccCc----ccccccccccccccccccccccccccccc---ccccc
Confidence            4579999999999999999998       3457889988    999999999999999985  456899998   55555


Q ss_pred             eecc-c----eeeEEEeeccce-ee-----eEEEEeeCCceEEeEEecCCCcceEEEEEccCCCCCCcEEEEEeCCCeEE
Q psy13856        102 LQPK-Y----FKLTVYSTKLTR-IL-----ILVRICGGDKWIEETKLENHSDWVRDVAWAPSWGLSKCMIASCSQDRKVI  170 (271)
Q Consensus       102 ~~~~-~----~~~~~~~~~~~~-l~-----~~v~i~~~~~~~~~~~~~~h~~~v~~v~~~p~~~~~~~~l~s~~~dg~i~  170 (271)
                      .... .    .....+.+++++ ++     +.|++.+....+....+.+|...|.++.|+|    ++.++++++.|+.++
T Consensus       139 ~~~l~~h~~~v~~v~~~~~~~~~l~sgs~d~~i~i~d~~~~~~~~~~~~~~~~i~~v~~~p----~~~~l~~~~~d~~v~  214 (311)
T d1nr0a1         139 NGNLTGQARAMNSVDFKPSRPFRIISGSDDNTVAIFEGPPFKFKSTFGEHTKFVHSVRYNP----DGSLFASTGGDGTIV  214 (311)
T ss_dssp             CBCCCCCSSCEEEEEECSSSSCEEEEEETTSCEEEEETTTBEEEEEECCCSSCEEEEEECT----TSSEEEEEETTSCEE
T ss_pred             cccccccccccccccccccceeeecccccccccccccccccccccccccccccccccccCc----ccccccccccccccc
Confidence            4443 1    233445556664 44     6788833333378888899999999999999    699999999999999


Q ss_pred             EEEcCCCceeee-----eeeccCCCCeEEEEEecCCCEEEEEECCCcEEEEEeCCCCceeEEEEecccch
Q psy13856        171 IWTSNDYVTWTP-----FIMNTFDDVVWNVSWSLTGDILTVSCGDNSVSLWKENTDGAWQCITEMGKTSE  235 (271)
Q Consensus       171 iwd~~~~~~~~~-----~~~~~h~~~v~~v~~~~~g~~l~s~s~D~~v~iw~~~~~~~~~~~~~~~~~~~  235 (271)
                      +||.+++.....     ....+|...|++++|+|++++|++|+.|++|+|||++++   +++.++..+..
T Consensus       215 ~~d~~~~~~~~~~~~~~~~~~~h~~~V~~~~~s~~~~~l~tgs~Dg~v~iwd~~t~---~~~~~l~~~~~  281 (311)
T d1nr0a1         215 LYNGVDGTKTGVFEDDSLKNVAHSGSVFGLTWSPDGTKIASASADKTIKIWNVATL---KVEKTIPVGTR  281 (311)
T ss_dssp             EEETTTCCEEEECBCTTSSSCSSSSCEEEEEECTTSSEEEEEETTSEEEEEETTTT---EEEEEEECCSS
T ss_pred             ccccccccccccccccccccccccccccccccCCCCCEEEEEeCCCeEEEEECCCC---cEEEEEECCCC
Confidence            999988764211     123468899999999999999999999999999999877   67777766543



>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure