Diaphorina citri psyllid: psy13863


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MATKCESYEIELWKINASTSHILASQCSELPDCDKSNSECDFCRYSTKLKIPHLPEMVFAGNILKLSHAGGCSLEFNAFDALSSVIVGEMPLQIACSEAWKSSRRSTGFTESHIHPFDWTYSTDYAGTLVGDWAIEKTSLQIDLEKLKQREKIHFYQDLILYEDELHDNGIAKCSVKIRVMSSGFFILLRFFLRVDDVLVRMNDTRLYHEYKNNFVLREISTRQASVKELRIPQSMISDEEPNLVNMLPLIKSETHKLMFQ
ccccccEEEEccEEEEEEEcccccccccccccccccccccHHHHHHHHccccccccEECcccEEEEEEccccEEEEcHHHHHHHHHcccccEEEEccHHHHccccccccccccccccccEEEcccccccccccccccccccccHHHHcccccccccccccHHccccccccEEEEEEEEEEcccHHHHHHHcEEEEccEEEEEEcEEEEEEccccEEEEEEEEEEcccccccccccccccccccHHcccccEEEEEEEEEEc
****CESYEIELWKINASTSHILASQCSELPDCDKSNSECDFCRYSTKLKIPHLPEMVFAGNILKLSHAGGCSLEFNAFDALSSVIVGEMPLQIACS************TESHIHPFDWTYSTDYAGTLVGDWAIEKTSLQIDLEKLKQREKIHFYQDLILYEDELHDNGIAKCSVKIRVMSSGFFILLRFFLRVDDVLVRMNDTRLYHEYKNNFVLREISTRQASVKELRIPQSMISDEEPNLVNMLPLIKSETHKLMFQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATKCESYEIELWKINASTSHILASQCSELPDCDKSNSECDFCRYSTKLKIPHLPEMVFAGNILKLSHAGGCSLEFNAFDALSSVIVGEMPLQIACSEAWKSSRRSTGFTESHIHPFDWTYSTDYAGTLVGDWAIEKTSLQIDLEKLKQREKIHFYQDLILYEDELHDNGIAKCSVKIRVMSSGFFILLRFFLRVDDVLVRMNDTRLYHEYKNNFVLREISTRQASVKELRIPQSMISDEEPNLVNMLPLIKSETHKLMFQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
TIP41-like protein May be a allosteric regulator of serine/threonine-protein phosphatase 2A (PP2A). Inhibits catalytic activity of the PP2A(D) core complex in vitro. The PP2A(C):TIPRL complex does not show phosphatase activity. May play a role in the regulation of ATM/ATR signaling pathway controlling DNA replication and repair.confidentA2VCX1
TIP41-like protein May be a regulator of serine/threonine-protein phosphatase 2A (PP2A).confidentQ5FW12
TIP41-like protein May be a allosteric regulator of serine/threonine-protein phosphatase 2A (PP2A). Inhibits catalytic activity of the PP2A(D) core complex in vitro. The PP2A(C):TIPRL complex does not show phosphatase activity. May play a role in the regulation of ATM/ATR signaling pathway controlling DNA replication and repair.confidentQ8BH58

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034048 [BP]negative regulation of protein phosphatase type 2A activityprobableGO:0060191, GO:0032515, GO:0019222, GO:0010921, GO:0010923, GO:0031323, GO:0051004, GO:0034047, GO:0019220, GO:0050789, GO:0051346, GO:0043086, GO:0065007, GO:0044092, GO:0065009, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0035303, GO:0051336, GO:0043666
GO:0018991 [BP]ovipositionprobableGO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0000077 [BP]DNA damage checkpointprobableGO:0051716, GO:0031570, GO:0000075, GO:0008150, GO:0050789, GO:0050896, GO:0009987, GO:0010564, GO:0010948, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0065007, GO:0044763, GO:0044699, GO:0033554, GO:0048519, GO:0048523, GO:0051726, GO:1901988

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted