Diaphorina citri psyllid: psy13877

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHTSNQPLQMGSSPAQVVKLTNPPVQTGQKMIVLTNNSNPPALEEKKFDRGIYNNEGLIASKLMKKGGQDRRKPERTSST
ccccccccccccccEEEEECccccccccEEEEEEEcccccccccccccCEEEEEEccccccccccEEEECcccccCCcccccHHHHHHcccccHHHHHHHcccccccccccccc
MCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHTSNQPLQMGSSPAQVVKLTNPPVQTGQKMIVLTNNSNPPALEEKKFDRGIYNNEGLIASKLMKKG*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCPSEDCQVNKSGGRLYLQTRGSKFVKFQELKVQEHTSNQPLQMGSSPAQVVKLTNPPVQTGQKMIVLTNNSNPPALEEKKFDRGIYNNEGLIASKLMKKGGQDRRKPERTSST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication licensing factor MCM7 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.confidentP33993
DNA replication licensing factor MCM7 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.confidentQ3ZBH9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0030174 [BP]regulation of DNA-dependent DNA replication initiationprobableGO:0009889, GO:0051052, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:2000112, GO:0006275, GO:0050794, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:0008150, GO:0090329, GO:0050789, GO:0080090
GO:0042555 [CC]MCM complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0004003 [MF]ATP-dependent DNA helicase activityprobableGO:0008094, GO:0016818, GO:0008026, GO:0042623, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003674, GO:0016887, GO:0003678, GO:0016462, GO:0003824
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0006268 [BP]DNA unwinding involved in replicationprobableGO:0071103, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0032392, GO:0006139, GO:0032508, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LTL, chain A
Confidence level:confident
Coverage over the Query: 2-75
View the alignment between query and template
View the model in PyMOL