Diaphorina citri psyllid: psy13885


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MEEEKVEKDKGREKERAIELRIFLQTLDEKEEEEEEEEEEEEKKEEEEKEEEKEEEEEEKEEEEEEEEEEEEEKEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFCTSVTNGLIDIRFYRSLKPNFTDFYPPQTDYSKRSDKQNCWPYDTPPPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVA
cccHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHcccccccccEEEEccccEEEEccHHHHHHHHccccccccccHHHHHHHHHHHHccccEEccccccEEEEEEccccccccccHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccCEEcccccEEECccHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccc
*******************************************************EEEEKEEEEEEEEEEEEEKEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFCTSVTNGLIDIRFYRSLKPNFTDFYPPQTDYSKRSDKQNCWPYDTPPPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEEKVEKDKGREKERAIExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFCTSVTNGLIDIRFYRSLKPNFTDFYPPQTDYSKRSDKQNCWPYDTPPPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0060762 [BP]regulation of branching involved in mammary gland duct morphogenesisprobableGO:0060688, GO:0022603, GO:0050793, GO:0008150, GO:2000026, GO:2000027, GO:0051239, GO:0065007, GO:0050789
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AVP, chain A
Confidence level:very confident
Coverage over the Query: 174-246
View the alignment between query and template
View the model in PyMOL
Template: 1WWX, chain A
Confidence level:confident
Coverage over the Query: 72-126
View the alignment between query and template
View the model in PyMOL