Psyllid ID: psy13885

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MEEEKVEKDKGREKERAIELRIFLQTLDEKEEEEEEEEEEEEKKEEEEKEEEKEEEEEEKEEEEEEEEEEEEEKEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFCTSVTNGLIDIRFYRSLKPNFTDFYPPQTDYSKRSDKQNCWPYDTPPPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVA
cccHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHcccccccccEEEEccccEEEEccHHHHHHHHccccccccccHHHHHHHHHHHHccccEEccccccEEEEEEcccccccccHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccEEEcccccEEEEccHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccc
cccHHEEcccccHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccccccccHHHHHHHHcccEEEcccHHHHHHHHHHHHccccccHHHHHHHHHcHHHHccEEEccccccEEEEccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccHHHccccEEcccccEEEcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccEEEcc
meeekvekDKGREKERAIELRIFLQTLDEKEEEEEEEEEEEEKKEEEEKEEEKEEEEEEKEEEEEEEEEEEEEKEVARRWgvqknrpamnydkLSRSLRYYYEKGIMQKVAGERYVYKFCTSVTnglidirfyrslkpnftdfyppqtdyskrsdkqncwpydtpppatprrgsLQLWQFLVALlddpnnascivwtgrgmefklvepeevarrwgvqknrpamnydkLSRSLRYYYEKGIMQKVA
meeekvekdkgrekeraielriflqtldekeeeeeeeeeeeekkeeeekeeekeeeeeekeeeeeeeeeeeeekevarrwgvqknrpamnydklsRSLRYYYEKGIMQKVAGERYVYKFCTSVTNGLIDIRFYRSLKPNFTDFYPPQtdyskrsdkqncwPYDTPPPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEpeevarrwgvqknrpamnydklsrslryyyekgimqkva
MEEEKVEKDKGREKERAIELRIFLQTLDekeeeeeeeeeeeekkeeeekeeekeeeeeekeeeeeeeeeeeeekeVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFCTSVTNGLIDIRFYRSLKPNFTDFYPPQTDYSKRSDKQNCWPYDTPPPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVA
*****************************************************************************************NYDKLSRSLRYYYEKGIMQKVAGERYVYKFCTSVTNGLIDIRFYRSLKPNFTDFYP*************CW*************SLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGI*****
*******************************************************EEEEKEEEEEEEEEEEEEKEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFCTSVTNGLIDIRFYRSLKPNFTDFYPPQTDYSKRSDKQNCWPYDTPPPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQK**
**************ERAIELRIFLQTLD**************************************************RWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFCTSVTNGLIDIRFYRSLKPNFTDFYPPQTDYSKRSDKQNCWPYDTPPPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVA
*********KGREKERAIELRIFLQTLDEKEE*********************EEEEEEKEEEEEEEEEEEEEKEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFCTSVTNGLIDIR****LKPN*TDFYPP**********QNCWPYDTPPPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEEKVEKDKGREKERAIExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFCTSVTNGLIDIRFYRSLKPNFTDFYPPQTDYSKRSDKQNCWPYDTPPPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query246 2.2.26 [Sep-21-2011]
P50549477 ETS translocation variant no N/A 0.325 0.167 0.875 1e-37
Q2KIC2477 ETS translocation variant yes N/A 0.325 0.167 0.875 1e-37
P41164477 ETS translocation variant no N/A 0.308 0.159 0.907 1e-37
Q9CXC9510 ETS translocation variant no N/A 0.304 0.147 0.907 2e-37
P41161510 ETS translocation variant no N/A 0.304 0.147 0.907 3e-37
P28322555 ETS translocation variant no N/A 0.308 0.136 0.894 5e-37
Q9PUQ1494 ETS translocation variant yes N/A 0.304 0.151 0.894 5e-37
P43268484 ETS translocation variant no N/A 0.308 0.157 0.894 7e-37
P29774 490 DNA-binding protein D-ETS no N/A 0.317 0.159 0.653 7e-26
P41157453 Retroviral integration si N/A N/A 0.317 0.172 0.641 3e-25
>sp|P50549|ETV1_HUMAN ETS translocation variant 1 OS=Homo sapiens GN=ETV1 PE=1 SV=2 Back     alignment and function desciption
 Score =  156 bits (395), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 70/80 (87%), Positives = 74/80 (92%)

Query: 167 PATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNY 226
           P   RRGSLQLWQFLVALLDDP+N+  I WTGRGMEFKL+EPEEVARRWG+QKNRPAMNY
Sbjct: 327 PTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNY 386

Query: 227 DKLSRSLRYYYEKGIMQKVA 246
           DKLSRSLRYYYEKGIMQKVA
Sbjct: 387 DKLSRSLRYYYEKGIMQKVA 406
Transcriptional activator that binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3'.
Homo sapiens (taxid: 9606)
>sp|Q2KIC2|ETV1_BOVIN ETS translocation variant 1 OS=Bos taurus GN=ETV1 PE=2 SV=1 Back     alignment and function description
>sp|P41164|ETV1_MOUSE ETS translocation variant 1 OS=Mus musculus GN=Etv1 PE=2 SV=1 Back     alignment and function description
>sp|Q9CXC9|ETV5_MOUSE ETS translocation variant 5 OS=Mus musculus GN=Etv5 PE=2 SV=1 Back     alignment and function description
>sp|P41161|ETV5_HUMAN ETS translocation variant 5 OS=Homo sapiens GN=ETV5 PE=1 SV=1 Back     alignment and function description
>sp|P28322|ETV4_MOUSE ETS translocation variant 4 OS=Mus musculus GN=Etv4 PE=2 SV=1 Back     alignment and function description
>sp|Q9PUQ1|ETV4_DANRE ETS translocation variant 4 OS=Danio rerio GN=etv4 PE=1 SV=2 Back     alignment and function description
>sp|P43268|ETV4_HUMAN ETS translocation variant 4 OS=Homo sapiens GN=ETV4 PE=1 SV=3 Back     alignment and function description
>sp|P29774|ETS3_DROME DNA-binding protein D-ETS-3 OS=Drosophila melanogaster GN=Ets65A PE=2 SV=3 Back     alignment and function description
>sp|P41157|FLI1_XENLA Retroviral integration site protein Fli-1 homolog OS=Xenopus laevis GN=fli1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
328697136160 PREDICTED: ETS translocation variant 5-l 0.337 0.518 0.915 5e-39
307182748 606 ETS translocation variant 1 [Camponotus 0.308 0.125 0.947 9e-38
322788563 430 hypothetical protein SINV_07623 [Solenop 0.308 0.176 0.947 2e-37
332024280 1029 ETS translocation variant 5 [Acromyrmex 0.308 0.073 0.947 2e-37
307193498 1156 ETS translocation variant 1 [Harpegnatho 0.308 0.065 0.947 2e-37
383858531 1022 PREDICTED: uncharacterized protein LOC10 0.308 0.074 0.934 3e-37
380024174 1028 PREDICTED: uncharacterized protein LOC10 0.308 0.073 0.934 5e-37
170032409 529 erm protein [Culex quinquefasciatus] gi| 0.308 0.143 0.922 5e-37
350415195 1033 PREDICTED: hypothetical protein LOC10075 0.308 0.073 0.934 5e-37
242014654260 erm, putative [Pediculus humanus corpori 0.341 0.323 0.857 8e-37
>gi|328697136|ref|XP_003240247.1| PREDICTED: ETS translocation variant 5-like, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  167 bits (422), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 76/83 (91%), Positives = 78/83 (93%)

Query: 164 TPPPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPA 223
           T PP   RRG+LQLWQFLV LLDDPNNASCIVWTGRGMEFKLVEPEEVARRWG+QKNRPA
Sbjct: 56  TAPPQPQRRGALQLWQFLVTLLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGLQKNRPA 115

Query: 224 MNYDKLSRSLRYYYEKGIMQKVA 246
           MNYDKLSRSLRYYYEKGIMQKVA
Sbjct: 116 MNYDKLSRSLRYYYEKGIMQKVA 138

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307182748|gb|EFN69872.1| ETS translocation variant 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322788563|gb|EFZ14191.1| hypothetical protein SINV_07623 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332024280|gb|EGI64482.1| ETS translocation variant 5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307193498|gb|EFN76275.1| ETS translocation variant 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383858531|ref|XP_003704754.1| PREDICTED: uncharacterized protein LOC100878455 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380024174|ref|XP_003695881.1| PREDICTED: uncharacterized protein LOC100867734 [Apis florea] Back     alignment and taxonomy information
>gi|170032409|ref|XP_001844074.1| erm protein [Culex quinquefasciatus] gi|167872360|gb|EDS35743.1| erm protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|350415195|ref|XP_003490560.1| PREDICTED: hypothetical protein LOC100750007 [Bombus impatiens] Back     alignment and taxonomy information
>gi|242014654|ref|XP_002428000.1| erm, putative [Pediculus humanus corporis] gi|212512519|gb|EEB15262.1| erm, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
UNIPROTKB|I3LUW2478 ETV1 "Uncharacterized protein" 0.325 0.167 0.875 2.4e-37
UNIPROTKB|E1C862478 ETV1 "Uncharacterized protein" 0.325 0.167 0.875 5.1e-35
UNIPROTKB|Q9YHW6477 ER81 "Uncharacterized protein" 0.325 0.167 0.875 5.1e-35
UNIPROTKB|Q2KIC2477 ETV1 "ETS translocation varian 0.325 0.167 0.875 5.1e-35
UNIPROTKB|E2RIU9477 ETV1 "Uncharacterized protein" 0.325 0.167 0.875 5.1e-35
UNIPROTKB|B5MCT2491 ETV1 "ETS translocation varian 0.325 0.162 0.875 5.1e-35
UNIPROTKB|P50549477 ETV1 "ETS translocation varian 0.325 0.167 0.875 5.1e-35
MGI|MGI:99254477 Etv1 "ets variant gene 1" [Mus 0.325 0.167 0.875 5.1e-35
RGD|1312007477 Etv1 "ets variant 1" [Rattus n 0.325 0.167 0.875 5.1e-35
ZFIN|ZDB-GENE-070104-1476 etv1 "ets variant gene 1" [Dan 0.325 0.168 0.875 5.1e-35
UNIPROTKB|I3LUW2 ETV1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 379 (138.5 bits), Expect = 2.4e-37, Sum P(2) = 2.4e-37
 Identities = 70/80 (87%), Positives = 74/80 (92%)

Query:   167 PATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNY 226
             P   RRGSLQLWQFLVALLDDP+N+  I WTGRGMEFKL+EPEEVARRWG+QKNRPAMNY
Sbjct:   328 PTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNY 387

Query:   227 DKLSRSLRYYYEKGIMQKVA 246
             DKLSRSLRYYYEKGIMQKVA
Sbjct:   388 DKLSRSLRYYYEKGIMQKVA 407
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IEA
GO:0007638 "mechanosensory behavior" evidence=IEA
GO:0007517 "muscle organ development" evidence=IEA
GO:0007411 "axon guidance" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
UNIPROTKB|E1C862 ETV1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9YHW6 ER81 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIC2 ETV1 "ETS translocation variant 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIU9 ETV1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B5MCT2 ETV1 "ETS translocation variant 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P50549 ETV1 "ETS translocation variant 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:99254 Etv1 "ets variant gene 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1312007 Etv1 "ets variant 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070104-1 etv1 "ets variant gene 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
pfam0017885 pfam00178, Ets, Ets-domain 2e-36
smart0041387 smart00413, ETS, erythroblast transformation speci 2e-36
pfam0017885 pfam00178, Ets, Ets-domain 2e-25
smart0041387 smart00413, ETS, erythroblast transformation speci 6e-25
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 9e-10
PRK04195482 PRK04195, PRK04195, replication factor C large sub 8e-08
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-07
pfam03344715 pfam03344, Daxx, Daxx Family 1e-06
pfam03344715 pfam03344, Daxx, Daxx Family 2e-06
pfam03344715 pfam03344, Daxx, Daxx Family 2e-06
pfam03344715 pfam03344, Daxx, Daxx Family 2e-06
pfam00183 529 pfam00183, HSP90, Hsp90 protein 2e-06
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 5e-06
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 5e-06
pfam04147 809 pfam04147, Nop14, Nop14-like family 6e-06
pfam03344715 pfam03344, Daxx, Daxx Family 7e-06
pfam04147 809 pfam04147, Nop14, Nop14-like family 9e-06
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 9e-06
pfam04546211 pfam04546, Sigma70_ner, Sigma-70, non-essential re 9e-06
pfam05758 832 pfam05758, Ycf1, Ycf1 9e-06
pfam04147 809 pfam04147, Nop14, Nop14-like family 1e-05
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 1e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-05
pfam03344715 pfam03344, Daxx, Daxx Family 2e-05
pfam03344715 pfam03344, Daxx, Daxx Family 2e-05
pfam04147 809 pfam04147, Nop14, Nop14-like family 2e-05
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 2e-05
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 2e-05
pfam03985431 pfam03985, Paf1, Paf1 2e-05
pfam04147 809 pfam04147, Nop14, Nop14-like family 3e-05
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 3e-05
pfam03985431 pfam03985, Paf1, Paf1 3e-05
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 3e-05
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 3e-05
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 3e-05
pfam03985431 pfam03985, Paf1, Paf1 4e-05
pfam11831363 pfam11831, Myb_Cef, pre-mRNA splicing factor compo 4e-05
PTZ00248319 PTZ00248, PTZ00248, eukaryotic translation initiat 4e-05
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 5e-05
pfam03985431 pfam03985, Paf1, Paf1 5e-05
PRK12585197 PRK12585, PRK12585, putative monovalent cation/H+ 5e-05
pfam03985431 pfam03985, Paf1, Paf1 6e-05
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 6e-05
pfam05285317 pfam05285, SDA1, SDA1 6e-05
pfam02724 583 pfam02724, CDC45, CDC45-like protein 8e-05
cd02988192 cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil 8e-05
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 9e-05
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 9e-05
pfam08553 794 pfam08553, VID27, VID27 cytoplasmic protein 9e-05
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 9e-05
pfam04147 809 pfam04147, Nop14, Nop14-like family 1e-04
pfam05285317 pfam05285, SDA1, SDA1 1e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 1e-04
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 1e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 1e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 1e-04
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 2e-04
pfam05285317 pfam05285, SDA1, SDA1 2e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 2e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 2e-04
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 2e-04
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 2e-04
TIGR03779410 TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative 2e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 2e-04
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 2e-04
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 3e-04
pfam05285317 pfam05285, SDA1, SDA1 3e-04
pfam08553 794 pfam08553, VID27, VID27 cytoplasmic protein 3e-04
pfam07133164 pfam07133, Merozoite_SPAM, Merozoite surface prote 3e-04
pfam07133164 pfam07133, Merozoite_SPAM, Merozoite surface prote 3e-04
pfam10310 436 pfam10310, DUF2413, Protein of unknown function (D 3e-04
TIGR01554 384 TIGR01554, major_cap_HK97, phage major capsid prot 3e-04
PHA00435306 PHA00435, PHA00435, capsid assembly protein 3e-04
pfam03344715 pfam03344, Daxx, Daxx Family 4e-04
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 4e-04
pfam05285317 pfam05285, SDA1, SDA1 4e-04
pfam09184285 pfam09184, PPP4R2, PPP4R2 4e-04
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 4e-04
pfam04774106 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi 4e-04
pfam04889241 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont 4e-04
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 4e-04
pfam00183 529 pfam00183, HSP90, Hsp90 protein 5e-04
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 5e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 5e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 5e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 5e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 5e-04
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 5e-04
pfam14283213 pfam14283, DUF4366, Domain of unknown function (DU 5e-04
pfam11081172 pfam11081, DUF2890, Protein of unknown function (D 5e-04
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 5e-04
pfam05285317 pfam05285, SDA1, SDA1 6e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 6e-04
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 6e-04
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 7e-04
pfam05285317 pfam05285, SDA1, SDA1 7e-04
pfam05285317 pfam05285, SDA1, SDA1 7e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 8e-04
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 8e-04
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 8e-04
PRK12298390 PRK12298, obgE, GTPase CgtA; Reviewed 8e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 8e-04
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 8e-04
pfam03344715 pfam03344, Daxx, Daxx Family 9e-04
PRK12585197 PRK12585, PRK12585, putative monovalent cation/H+ 9e-04
pfam03896281 pfam03896, TRAP_alpha, Translocon-associated prote 9e-04
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 9e-04
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 0.001
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.001
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.001
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.001
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 0.001
cd02988192 cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil 0.001
pfam08553 794 pfam08553, VID27, VID27 cytoplasmic protein 0.001
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.001
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.001
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.001
pfam09184285 pfam09184, PPP4R2, PPP4R2 0.001
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.001
pfam11081172 pfam11081, DUF2890, Protein of unknown function (D 0.001
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 0.001
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 0.001
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 0.001
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
pfam00183 529 pfam00183, HSP90, Hsp90 protein 0.002
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 0.002
pfam03985431 pfam03985, Paf1, Paf1 0.002
pfam05285317 pfam05285, SDA1, SDA1 0.002
pfam05285317 pfam05285, SDA1, SDA1 0.002
pfam08553 794 pfam08553, VID27, VID27 cytoplasmic protein 0.002
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 0.002
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 0.002
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 0.002
pfam09184285 pfam09184, PPP4R2, PPP4R2 0.002
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 0.002
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 0.002
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 0.002
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 0.002
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 0.002
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 0.002
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 0.002
PRK13108460 PRK13108, PRK13108, prolipoprotein diacylglyceryl 0.002
PRK13108460 PRK13108, PRK13108, prolipoprotein diacylglyceryl 0.002
pfam09756189 pfam09756, DDRGK, DDRGK domain 0.002
pfam09756189 pfam09756, DDRGK, DDRGK domain 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
pfam04111356 pfam04111, APG6, Autophagy protein Apg6 0.002
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 0.002
PRK14521186 PRK14521, rpsP, 30S ribosomal protein S16; Provisi 0.002
pfam08597242 pfam08597, eIF3_subunit, Translation initiation fa 0.002
pfam09736141 pfam09736, Bud13, Pre-mRNA-splicing factor of RES 0.002
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.002
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.002
pfam04177335 pfam04177, TAP42, TAP42-like family 0.002
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 0.002
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.003
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.003
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.003
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 0.003
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 0.003
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 0.003
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 0.003
pfam03896281 pfam03896, TRAP_alpha, Translocon-associated prote 0.003
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 0.003
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 0.003
pfam09756189 pfam09756, DDRGK, DDRGK domain 0.003
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.003
pfam10446 449 pfam10446, DUF2457, Protein of unknown function (D 0.003
PRK05299258 PRK05299, rpsB, 30S ribosomal protein S2; Provisio 0.003
PRK14520155 PRK14520, rpsP, 30S ribosomal protein S16; Provisi 0.003
PRK05658 619 PRK05658, PRK05658, RNA polymerase sigma factor Rp 0.003
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.004
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.004
PTZ00248319 PTZ00248, PTZ00248, eukaryotic translation initiat 0.004
cd02988192 cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil 0.004
cd02988192 cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil 0.004
pfam09184285 pfam09184, PPP4R2, PPP4R2 0.004
pfam11081172 pfam11081, DUF2890, Protein of unknown function (D 0.004
pfam11081172 pfam11081, DUF2890, Protein of unknown function (D 0.004
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 0.004
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 0.004
COG0576193 COG0576, GrpE, Molecular chaperone GrpE (heat shoc 0.004
PRK13766773 PRK13766, PRK13766, Hef nuclease; Provisional 0.004
COG5167 776 COG5167, VID27, Protein involved in vacuole import 0.004
COG4547 620 COG4547, CobT, Cobalamin biosynthesis protein CobT 0.004
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 0.004
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 0.004
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.004
pfam07222243 pfam07222, PBP_sp32, Proacrosin binding protein sp 0.004
pfam10156 454 pfam10156, Med17, Subunit 17 of Mediator complex 0.004
>gnl|CDD|143944 pfam00178, Ets, Ets-domain Back     alignment and domain information 
 Score =  123 bits (311), Expect = 2e-36
 Identities = 49/73 (67%), Positives = 60/73 (82%), Gaps = 1/73 (1%)

Query: 175 LQLWQFLVALLDDPNNASCIVWTGR-GMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSL 233
           +QLWQFL+ LL D +N   I WTGR   EFKLV+PEEVAR WG++KN+P MNYDKLSR+L
Sbjct: 2   IQLWQFLLELLTDQDNRDFIRWTGRDKGEFKLVDPEEVARLWGIRKNKPNMNYDKLSRAL 61

Query: 234 RYYYEKGIMQKVA 246
           RYYY+KGI++KV 
Sbjct: 62  RYYYKKGIIRKVK 74

Length = 85
>gnl|CDD|197710 smart00413, ETS, erythroblast transformation specific domain Back     alignment and domain information
>gnl|CDD|143944 pfam00178, Ets, Ets-domain Back     alignment and domain information
>gnl|CDD|197710 smart00413, ETS, erythroblast transformation specific domain Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component Back     alignment and domain information
>gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|234352 TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative transposon TraM protein Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) Back     alignment and domain information
>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) Back     alignment and domain information
>gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family Back     alignment and domain information
>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) Back     alignment and domain information
>gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed Back     alignment and domain information
>gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information
>gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217902 pfam04111, APG6, Autophagy protein Apg6 Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|217940 pfam04177, TAP42, TAP42-like family Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) Back     alignment and domain information
>gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional Back     alignment and domain information
>gnl|CDD|184724 PRK14520, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 Back     alignment and domain information
>gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) Back     alignment and domain information
>gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|148682 pfam07222, PBP_sp32, Proacrosin binding protein sp32 Back     alignment and domain information
>gnl|CDD|220605 pfam10156, Med17, Subunit 17 of Mediator complex Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 246
KOG3806|consensus177 100.0
smart0041387 ETS erythroblast transformation specific domain. v 100.0
PF0017885 Ets: Ets-domain; InterPro: IPR000418 Transcription 100.0
KOG3804|consensus390 99.97
KOG3805|consensus361 99.95
KOG3806|consensus177 99.81
smart0041387 ETS erythroblast transformation specific domain. v 99.8
PF0017885 Ets: Ets-domain; InterPro: IPR000418 Transcription 99.69
KOG3805|consensus361 99.49
KOG3804|consensus390 99.41
PF00447103 HSF_DNA-bind: HSF-type DNA-binding; InterPro: IPR0 96.83
smart00415105 HSF heat shock factor. 96.61
COG5169 282 HSF1 Heat shock transcription factor [Transcriptio 93.28
KOG0627|consensus 304 81.6
>KOG3806|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.5e-36  Score=253.51  Aligned_cols=80  Identities=63%  Similarity=1.172  Sum_probs=75.9

Q ss_pred             CCCCCCCchhhHHHHHHhcCCCCCCCceeeecC-cceEEEeChHHHHHHHhhhcCCCCCCHHHHHHHHHHhhhccceeeC
Q psy13885        167 PATPRRGSLQLWQFLVALLDDPNNASCIVWTGR-GMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKV  245 (246)
Q Consensus       167 ~~~~~~g~~~Lw~FLl~lL~d~~~~~~I~Wt~~-~~eF~~~d~~~va~lWg~~k~~~~m~y~klsR~lR~yy~~~il~kv  245 (246)
                      ..++++|++|||||||+||.|+++++||+|||+ +++|+|+||++||||||.+||||+||||||||||||||++|||.||
T Consensus        61 ~s~~~sg~iqLwqFLleLl~d~~~~~~I~Wtg~~g~EFkl~dp~eVArlWG~rK~kp~MNYdKLSRaLRyyY~kni~~Kv  140 (177)
T KOG3806|consen   61 ESTSGSGQIQLWQFLLELLQDESNAHIIAWTGKDGLEFKLVDPDEVARLWGARKNKPNMNYDKLSRALRYYYDKNILKKV  140 (177)
T ss_pred             ccCCCCchhhHHHHHHHHHhCcccCCeeEEeCCCCceEEecCHHHHHHHHhhhhCCCCCCHHHHHHHHHHHHhcCceeec
Confidence            345678999999999999999999999999997 5699999999999999999999999999999999999999999999


Q ss_pred             C
Q psy13885        246 A  246 (246)
Q Consensus       246 ~  246 (246)
                      +
T Consensus       141 ~  141 (177)
T KOG3806|consen  141 P  141 (177)
T ss_pred             C
Confidence            6

>smart00413 ETS erythroblast transformation specific domain Back     alignment and domain information
>PF00178 Ets: Ets-domain; InterPro: IPR000418 Transcription factors are protein molecules that bind to specific DNA sequences in the genome, resulting in the induction or inhibition of gene transcription [] Back     alignment and domain information
>KOG3804|consensus Back     alignment and domain information
>KOG3805|consensus Back     alignment and domain information
>KOG3806|consensus Back     alignment and domain information
>smart00413 ETS erythroblast transformation specific domain Back     alignment and domain information
>PF00178 Ets: Ets-domain; InterPro: IPR000418 Transcription factors are protein molecules that bind to specific DNA sequences in the genome, resulting in the induction or inhibition of gene transcription [] Back     alignment and domain information
>KOG3805|consensus Back     alignment and domain information
>KOG3804|consensus Back     alignment and domain information
>PF00447 HSF_DNA-bind: HSF-type DNA-binding; InterPro: IPR000232 Heat shock factor (HSF) is a transcriptional activator of heat shock genes []: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs [] Back     alignment and domain information
>smart00415 HSF heat shock factor Back     alignment and domain information
>COG5169 HSF1 Heat shock transcription factor [Transcription] Back     alignment and domain information
>KOG0627|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
4avp_A106 Crystal Structure Of The Dna-Binding Domain Of Huma 1e-37
1fli_A98 Dna-Binding Domain Of Fli-1 Length = 98 7e-25
2ypr_A102 Crystal Structure Of The Dna Binding Ets Domain Of 2e-23
2nny_A171 Crystal Structure Of The Ets1 Dimer Dna Complex. Le 4e-23
3ri4_A163 Ets1 Cooperative Binding To Widely Separated Sites 2e-22
3mfk_A162 Ets1 Complex With Stromelysin-1 Promoter Dna Length 2e-22
1r36_A140 Nmr-Based Structure Of Autoinhibited Murine Ets-1 D 2e-22
1mdm_B161 Inhibited Fragment Of Ets-1 And Paired Domain Of Pa 2e-22
1gvj_A146 Ets-1 Dna Binding And Autoinhibitory Domains Length 3e-22
1md0_A141 Crystal Structure Of An Inhibited Fragment Of Ets-1 3e-22
1k78_B110 Pax5(1-149)+ets-1(331-440)+dna Length = 110 4e-22
2stt_A96 Solution Nmr Structure Of The Human Ets1DNA COMPLEX 4e-22
1dux_C94 Elk-1DNA STRUCTURE REVEALS HOW RESIDUES DISTAL FROM 1e-19
1awc_A110 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 4e-18
1hbx_G157 Ternary Complex Of Sap-1 And Srf With Specific Sre 2e-15
1bc7_C93 Serum Response Factor Accessory Protein 1a (Sap-1)D 2e-15
1yo5_C97 Analysis Of The 2.0a Crystal Structure Of The Prote 8e-14
2lf7_A106 Intramolecular Regulation Of The Ets Domain Within 3e-09
2dao_A118 Solution Structure Of Ets Domain Transcriptional Fa 3e-09
2lf8_A128 Intramolecular Regulation Of The Ets Domain Within 3e-09
1wwx_A107 Solution Structure Of The Ets-Domain Of The Ets Dom 4e-09
3jtg_A103 Crystal Structure Of Mouse Elf3 C-Terminal Dna-Bind 3e-08
1pue_E89 Pu.1 Ets Domain-Dna Complex Length = 89 6e-07
>pdb|4AVP|A Chain A, Crystal Structure Of The Dna-Binding Domain Of Human Etv1. Length = 106 Back     alignment and structure 
Iteration: 1

 Score =  152 bits (385), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 70/80 (87%), Positives = 75/80 (93%)
Query: 167 PATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNY 226
           P + RRGSLQLWQFLVALLDDP+N+  I WTGRGMEFKL+EPEEVARRWG+QKNRPAMNY
Sbjct: 4   PTSQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNY 63
Query: 227 DKLSRSLRYYYEKGIMQKVA 246
           DKLSRSLRYYYEKGIMQKVA
Sbjct: 64  DKLSRSLRYYYEKGIMQKVA 83
>pdb|1FLI|A Chain A, Dna-Binding Domain Of Fli-1 Length = 98 Back     alignment and structure
>pdb|2YPR|A Chain A, Crystal Structure Of The Dna Binding Ets Domain Of Human Protein Fev Length = 102 Back     alignment and structure
>pdb|2NNY|A Chain A, Crystal Structure Of The Ets1 Dimer Dna Complex. Length = 171 Back     alignment and structure
>pdb|3RI4|A Chain A, Ets1 Cooperative Binding To Widely Separated Sites On Promoter Dna Length = 163 Back     alignment and structure
>pdb|3MFK|A Chain A, Ets1 Complex With Stromelysin-1 Promoter Dna Length = 162 Back     alignment and structure
>pdb|1R36|A Chain A, Nmr-Based Structure Of Autoinhibited Murine Ets-1 Deltan301 Length = 140 Back     alignment and structure
>pdb|1MDM|B Chain B, Inhibited Fragment Of Ets-1 And Paired Domain Of Pax5 Bound To Dna Length = 161 Back     alignment and structure
>pdb|1GVJ|A Chain A, Ets-1 Dna Binding And Autoinhibitory Domains Length = 146 Back     alignment and structure
>pdb|1MD0|A Chain A, Crystal Structure Of An Inhibited Fragment Of Ets-1 Length = 141 Back     alignment and structure
>pdb|1K78|B Chain B, Pax5(1-149)+ets-1(331-440)+dna Length = 110 Back     alignment and structure
>pdb|2STT|A Chain A, Solution Nmr Structure Of The Human Ets1DNA COMPLEX, 25 Structures Length = 96 Back     alignment and structure
>pdb|1DUX|C Chain C, Elk-1DNA STRUCTURE REVEALS HOW RESIDUES DISTAL FROM DNA- Binding Surface Affect Dna-Recognition Length = 94 Back     alignment and structure
>pdb|1AWC|A Chain A, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 110 Back     alignment and structure
>pdb|1HBX|G Chain G, Ternary Complex Of Sap-1 And Srf With Specific Sre Dna Length = 157 Back     alignment and structure
>pdb|1BC7|C Chain C, Serum Response Factor Accessory Protein 1a (Sap-1)DNA Complex Length = 93 Back     alignment and structure
>pdb|1YO5|C Chain C, Analysis Of The 2.0a Crystal Structure Of The Protein-Dna Complex Of Human Pdef Ets Domain Bound To The Prostate Specific Antigen Regulatory Site Length = 97 Back     alignment and structure
>pdb|2LF7|A Chain A, Intramolecular Regulation Of The Ets Domain Within Etv6 Sequence R335 To Q436 Length = 106 Back     alignment and structure
>pdb|2DAO|A Chain A, Solution Structure Of Ets Domain Transcriptional Factor Etv6 Protein Length = 118 Back     alignment and structure
>pdb|2LF8|A Chain A, Intramolecular Regulation Of The Ets Domain Within Etv6 Sequence R335 To R458 Length = 128 Back     alignment and structure
>pdb|1WWX|A Chain A, Solution Structure Of The Ets-Domain Of The Ets Domain Transcription Factor Length = 107 Back     alignment and structure
>pdb|3JTG|A Chain A, Crystal Structure Of Mouse Elf3 C-Terminal Dna-Binding Domai Complex With Type Ii Tgf-Beta Receptor Promoter Dna Length = 103 Back     alignment and structure
>pdb|1PUE|E Chain E, Pu.1 Ets Domain-Dna Complex Length = 89 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
4avp_A106 ETS translocation variant 1; transcription, transc 100.0
1fli_A98 FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: 100.0
1bc8_C93 SAP-1, protein (SAP-1 ETS domain); DNA-binding dom 100.0
2ypr_A102 Protein FEV; transcription; 2.64A {Homo sapiens} P 100.0
1wwx_A107 E74-like factor 5 ESE-2B; DNA binding, transcripti 100.0
1yo5_C97 SAM pointed domain containing ETS transcription fa 100.0
2dao_A118 Transcription factor ETV6; ETS domain, structural 100.0
1awc_A110 Protein (GA binding protein alpha); complex (trans 100.0
1gvj_A146 C-ETS-1 protein, P54; transcription, autoinhibitio 100.0
1pue_E89 Protein (transcription factor PU.1 (TF PU.1)); com 100.0
2nny_A171 C-ETS-1 protein, P54; protein-DNA complex, transcr 100.0
1hbx_G157 ETS-domain protein ELK-4; gene regulation, transcr 100.0
3jtg_A103 ETS-related transcription factor ELF-3; ELF3, prot 99.98
2lf8_A128 Transcription factor ETV6; auto-inhibition; NMR {M 99.96
1bc8_C93 SAP-1, protein (SAP-1 ETS domain); DNA-binding dom 99.8
2dao_A118 Transcription factor ETV6; ETS domain, structural 99.79
1fli_A98 FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: 99.79
4avp_A106 ETS translocation variant 1; transcription, transc 99.78
1awc_A110 Protein (GA binding protein alpha); complex (trans 99.78
1yo5_C97 SAM pointed domain containing ETS transcription fa 99.78
2lf8_A128 Transcription factor ETV6; auto-inhibition; NMR {M 99.64
3jtg_A103 ETS-related transcription factor ELF-3; ELF3, prot 99.77
2ypr_A102 Protein FEV; transcription; 2.64A {Homo sapiens} P 99.76
1hbx_G157 ETS-domain protein ELK-4; gene regulation, transcr 99.76
1wwx_A107 E74-like factor 5 ESE-2B; DNA binding, transcripti 99.76
1pue_E89 Protein (transcription factor PU.1 (TF PU.1)); com 99.75
1gvj_A146 C-ETS-1 protein, P54; transcription, autoinhibitio 99.75
2nny_A171 C-ETS-1 protein, P54; protein-DNA complex, transcr 99.74
2ldu_A125 Heat shock factor protein 1; structural genomics, 96.21
1hks_A106 Heat-shock transcription factor; transcription reg 96.03
3hts_B102 Heat shock transcription factor; transcription reg 96.02
>4avp_A ETS translocation variant 1; transcription, transcriptional activation and repression, DN binding protein, E twenty-SIX, erwing sarcoma; 1.82A {Homo sapiens} PDB: 4b06_A Back     alignment and structure
Probab=100.00  E-value=4.6e-37  Score=240.08  Aligned_cols=81  Identities=86%  Similarity=1.432  Sum_probs=72.1

Q ss_pred             CCCCCCCCchhhHHHHHHhcCCCCCCCceeeecCcceEEEeChHHHHHHHhhhcCCCCCCHHHHHHHHHHhhhccceeeC
Q psy13885        166 PPATPRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKV  245 (246)
Q Consensus       166 ~~~~~~~g~~~Lw~FLl~lL~d~~~~~~I~Wt~~~~eF~~~d~~~va~lWg~~k~~~~m~y~klsR~lR~yy~~~il~kv  245 (246)
                      ||+++++|+++|||||++||.|+++++||+|||++++|+|+||++||+|||++|||++|||+||||||||||++|||+||
T Consensus         3 ~~~~~~~g~i~LwqFL~~LL~d~~~~~~I~W~~~~~~Fkl~dp~~VA~lWG~rKnkp~M~YeKlSRaLRyYY~kgii~Kv   82 (106)
T 4avp_A            3 GPTSQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKV   82 (106)
T ss_dssp             --------CCCHHHHHHHHHHCGGGTTTEEECSSTTEEEESSHHHHHHHHHHHTTCTTCCHHHHHHHHHHHHHHTSEEEC
T ss_pred             CCCCCCCCcEeHHHHHHHHHcCccCCCCCcccCCCceEEecCHHHHHHHHHhccCCCCcCHHHHHHHHHHHHhcCeEEec
Confidence            78889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             C
Q psy13885        246 A  246 (246)
Q Consensus       246 ~  246 (246)
                      +
T Consensus        83 ~   83 (106)
T 4avp_A           83 A   83 (106)
T ss_dssp             T
T ss_pred             C
Confidence            5
>1fli_A FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>1bc8_C SAP-1, protein (SAP-1 ETS domain); DNA-binding domain, winged helix-turn-helix, DNA-binding specificity, transcription/DNA complex; HET: DNA; 1.93A {Homo sapiens} SCOP: a.4.5.21 PDB: 1bc7_C* 1k6o_A 1dux_C* Back     alignment and structure
>2ypr_A Protein FEV; transcription; 2.64A {Homo sapiens} PDB: 1fli_A Back     alignment and structure
>1wwx_A E74-like factor 5 ESE-2B; DNA binding, transcriptional activation and repression, structural genomics; NMR {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>1yo5_C SAM pointed domain containing ETS transcription factor; protein-DNA complex, double helix, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>2dao_A Transcription factor ETV6; ETS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1awc_A Protein (GA binding protein alpha); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>1gvj_A C-ETS-1 protein, P54; transcription, autoinhibition, ETS domain; 1.53A {Homo sapiens} SCOP: a.4.5.21 PDB: 1md0_A 1r36_A 1k78_B 1k79_A* 1k7a_A* 2stt_A* 2stw_A* Back     alignment and structure
>1pue_E Protein (transcription factor PU.1 (TF PU.1)); complex (transcription regulating/DNA), oncogene, transforming protein, DNA- binding, activator; HET: DNA; 2.10A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>2nny_A C-ETS-1 protein, P54; protein-DNA complex, transcription/DNA complex; 2.58A {Homo sapiens} PDB: 3ri4_A 3mfk_A 1mdm_B Back     alignment and structure
>1hbx_G ETS-domain protein ELK-4; gene regulation, transcription complex; 3.15A {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>3jtg_A ETS-related transcription factor ELF-3; ELF3, protein-DNA complex, type II TGF-beta receptor, activa alternative splicing, cytoplasm; HET: DNA; 2.20A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>2lf8_A Transcription factor ETV6; auto-inhibition; NMR {Mus musculus} Back     alignment and structure
>1bc8_C SAP-1, protein (SAP-1 ETS domain); DNA-binding domain, winged helix-turn-helix, DNA-binding specificity, transcription/DNA complex; HET: DNA; 1.93A {Homo sapiens} SCOP: a.4.5.21 PDB: 1bc7_C* 1k6o_A 1dux_C* Back     alignment and structure
>2dao_A Transcription factor ETV6; ETS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fli_A FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>4avp_A ETS translocation variant 1; transcription, transcriptional activation and repression, DN binding protein, E twenty-SIX, erwing sarcoma; 1.82A {Homo sapiens} PDB: 4b06_A Back     alignment and structure
>1awc_A Protein (GA binding protein alpha); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>1yo5_C SAM pointed domain containing ETS transcription factor; protein-DNA complex, double helix, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>2lf8_A Transcription factor ETV6; auto-inhibition; NMR {Mus musculus} Back     alignment and structure
>3jtg_A ETS-related transcription factor ELF-3; ELF3, protein-DNA complex, type II TGF-beta receptor, activa alternative splicing, cytoplasm; HET: DNA; 2.20A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>2ypr_A Protein FEV; transcription; 2.64A {Homo sapiens} PDB: 1fli_A Back     alignment and structure
>1hbx_G ETS-domain protein ELK-4; gene regulation, transcription complex; 3.15A {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>1wwx_A E74-like factor 5 ESE-2B; DNA binding, transcriptional activation and repression, structural genomics; NMR {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>1pue_E Protein (transcription factor PU.1 (TF PU.1)); complex (transcription regulating/DNA), oncogene, transforming protein, DNA- binding, activator; HET: DNA; 2.10A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>1gvj_A C-ETS-1 protein, P54; transcription, autoinhibition, ETS domain; 1.53A {Homo sapiens} SCOP: a.4.5.21 PDB: 1md0_A 1r36_A 1k78_B 1k79_A* 1k7a_A* 2stt_A* 2stw_A* Back     alignment and structure
>2nny_A C-ETS-1 protein, P54; protein-DNA complex, transcription/DNA complex; 2.58A {Homo sapiens} PDB: 3ri4_A 3mfk_A 1mdm_B Back     alignment and structure
>2ldu_A Heat shock factor protein 1; structural genomics, northeast structural genomics consortiu DNA-binding, PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1hks_A Heat-shock transcription factor; transcription regulation; NMR {Drosophila melanogaster} SCOP: a.4.5.22 PDB: 1hkt_A Back     alignment and structure
>3hts_B Heat shock transcription factor; transcription regulation, DNA-binding protein, complex (WING helix_TURN_ helix-DNA); 1.75A {Kluyveromyces lactis} SCOP: a.4.5.22 PDB: 2hts_A 1fyk_A* 1fym_A 1fyl_A 3hsf_A 1fbu_A 1fbs_A 1fbq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 246
d1flia_98 a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 4e-35
d1flia_98 a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 2e-19
d1hbxg_155 a.4.5.21 (G:) Serum response factor accessory prot 4e-35
d1hbxg_155 a.4.5.21 (G:) Serum response factor accessory prot 2e-19
d1gvja_142 a.4.5.21 (A:) ETS-1 transcription factor, residues 1e-34
d1gvja_142 a.4.5.21 (A:) ETS-1 transcription factor, residues 4e-18
d1awca_110 a.4.5.21 (A:) GA binding protein (GABP) alpha {Mou 3e-31
d1awca_110 a.4.5.21 (A:) GA binding protein (GABP) alpha {Mou 4e-18
d1duxc_86 a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 2e-30
d1duxc_86 a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 3e-19
d1yo5c188 a.4.5.21 (C:247-334) Sam pointed domain containing 1e-29
d1yo5c188 a.4.5.21 (C:247-334) Sam pointed domain containing 7e-19
d1puee_88 a.4.5.21 (E:) Transcription factor PU.1, residues 3e-29
d1puee_88 a.4.5.21 (E:) Transcription factor PU.1, residues 2e-16
d1wwxa194 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human 1e-28
d1wwxa194 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human 3e-17
>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: ets domain
domain: Fli-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  118 bits (298), Expect = 4e-35
 Identities = 49/76 (64%), Positives = 59/76 (77%)

Query: 170 PRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKL 229
           P  G +QLWQFL+ LL D  NASCI W G   EFK+ +P+EVARRWG +K++P MNYDKL
Sbjct: 1   PGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKL 60

Query: 230 SRSLRYYYEKGIMQKV 245
           SR+LRYYY+K IM KV
Sbjct: 61  SRALRYYYDKNIMTKV 76
>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d1gvja_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1gvja_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1awca_ a.4.5.21 (A:) GA binding protein (GABP) alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1awca_ a.4.5.21 (A:) GA binding protein (GABP) alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1duxc_ a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1duxc_ a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1yo5c1 a.4.5.21 (C:247-334) Sam pointed domain containing ets transcription SPDEF {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1yo5c1 a.4.5.21 (C:247-334) Sam pointed domain containing ets transcription SPDEF {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1puee_ a.4.5.21 (E:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1puee_ a.4.5.21 (E:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1wwxa1 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wwxa1 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
d1flia_98 Fli-1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1duxc_86 Elk-1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1awca_110 GA binding protein (GABP) alpha {Mouse (Mus muscul 100.0
d1gvja_142 ETS-1 transcription factor, residues 331-440 {Huma 100.0
d1puee_88 Transcription factor PU.1, residues 171-259 {Mouse 100.0
d1yo5c188 Sam pointed domain containing ets transcription SP 100.0
d1wwxa194 E74-like factor 5 ese-2b {Human (Homo sapiens) [Ta 100.0
d1hbxg_155 Serum response factor accessory protein 1a, SAP-1 100.0
d1duxc_86 Elk-1 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1hbxg_155 Serum response factor accessory protein 1a, SAP-1 99.79
d1yo5c188 Sam pointed domain containing ets transcription SP 99.77
d1awca_110 GA binding protein (GABP) alpha {Mouse (Mus muscul 99.77
d1flia_98 Fli-1 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1wwxa194 E74-like factor 5 ese-2b {Human (Homo sapiens) [Ta 99.76
d1gvja_142 ETS-1 transcription factor, residues 331-440 {Huma 99.74
d1puee_88 Transcription factor PU.1, residues 171-259 {Mouse 99.73
d2htsa_92 Heat-shock transcription factor {Milk yeast (Kluyv 97.01
d1hksa_106 Heat-shock transcription factor {Drosophila melano 96.63
>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: ets domain
domain: Fli-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8.2e-37  Score=233.14  Aligned_cols=77  Identities=64%  Similarity=1.203  Sum_probs=74.5

Q ss_pred             CCCCchhhHHHHHHhcCCCCCCCceeeecCcceEEEeChHHHHHHHhhhcCCCCCCHHHHHHHHHHhhhccceeeCC
Q psy13885        170 PRRGSLQLWQFLVALLDDPNNASCIVWTGRGMEFKLVEPEEVARRWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVA  246 (246)
Q Consensus       170 ~~~g~~~Lw~FLl~lL~d~~~~~~I~Wt~~~~eF~~~d~~~va~lWg~~k~~~~m~y~klsR~lR~yy~~~il~kv~  246 (246)
                      +++|+++||+||++||.|+++++||+|++++++|+|+|+++||+|||.+|||++|||+||||||||||++|||.||+
T Consensus         1 pg~g~~~Lw~FL~~LL~d~~~~~~I~W~~~~geFkl~~~~~VA~lWG~~Knk~~M~YeklSRaLRyYY~~~il~Kv~   77 (98)
T d1flia_           1 PGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVH   77 (98)
T ss_dssp             CCCSSCCSHHHHHHHHHTCSSCSSEECTTSSSSCEECCHHHHHHHHHHHTCCTTCSSHHHHHHHHHHHHTTSCCCBG
T ss_pred             CCCCcccHHHHHHHHhcCcccCCceEEECCCCEEEeCCHHHHHHHHHHhhcCCCccHHHHHHHHHHHHhccceeecc
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999994
>d1duxc_ a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awca_ a.4.5.21 (A:) GA binding protein (GABP) alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvja_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puee_ a.4.5.21 (E:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yo5c1 a.4.5.21 (C:247-334) Sam pointed domain containing ets transcription SPDEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwxa1 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1duxc_ a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo5c1 a.4.5.21 (C:247-334) Sam pointed domain containing ets transcription SPDEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awca_ a.4.5.21 (A:) GA binding protein (GABP) alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwxa1 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvja_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puee_ a.4.5.21 (E:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2htsa_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1hksa_ a.4.5.22 (A:) Heat-shock transcription factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure