Diaphorina citri psyllid: psy13887


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MFPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAREIAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAWP
ccccccccHHHHHHHHHHHccccccccEEEEEccccccEEEcccccEEEEEccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccc
*FPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATL**********************************DFNKKILHTAWP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAREIAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAWP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform B regulatory subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit. The activity of PP2A complexes containing PPP2R2D (PR55-delta) fluctuate during the cell cycle: the activity is high in interphase and low in mitosis. During mitosis, activity of PP2A is inhibited via interaction with phosphorylated ENSA and ARPP19 inhibitors. Within the PP2A complexes, the B regulatory subunits modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.confidentQ66LE6
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform B regulatory subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit. The activity of PP2A complexes containing PPP2R2D (PR55-delta) fluctuate during the cell cycle: the activity is high in interphase and low in mitosis. During mitosis, activity of PP2A is inhibited via interaction with phosphorylated ENSA and ARPP19 inhibitors. Within the PP2A complexes, the B regulatory subunits modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.confidentQ5ZIY5
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform B regulatory subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit. The activity of PP2A complexes containing PPP2R2D (PR55-delta) fluctuate during the cell cycle: the activity is high in interphase and low in mitosis. During mitosis, activity of PP2A is inhibited via interaction with phosphorylated ENSA and ARPP19 inhibitors. Within the PP2A complexes, the B regulatory subunits modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.confidentQ925E7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partconfidentGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043234 [CC]protein complexconfidentGO:0005575, GO:0032991
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000159 [CC]protein phosphatase type 2A complexprobableGO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0006470 [BP]protein dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0043525 [BP]positive regulation of neuron apoptotic processprobableGO:0050789, GO:0050794, GO:0043065, GO:0010942, GO:0043067, GO:0043523, GO:0065007, GO:0048518, GO:1901216, GO:0008150, GO:1901214, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0034047 [BP]regulation of protein phosphatase type 2A activityprobableGO:0051336, GO:0019220, GO:0043666, GO:0019222, GO:0010921, GO:0050790, GO:0031323, GO:0050789, GO:0051174, GO:0065007, GO:0008150, GO:0035303, GO:0050794, GO:0065009
GO:0004722 [MF]protein serine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0007088 [BP]regulation of mitosisprobableGO:0007346, GO:0051726, GO:0033043, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051128, GO:0050789
GO:0051297 [BP]centrosome organizationprobableGO:0006996, GO:0031023, GO:0007010, GO:0009987, GO:0016043, GO:0008150, GO:0007017, GO:0044763, GO:0071840, GO:0000226, GO:0044699
GO:0007286 [BP]spermatid developmentprobableGO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987
GO:0007447 [BP]imaginal disc pattern formationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007275, GO:0044699
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006626 [BP]protein targeting to mitochondrionprobableGO:0008104, GO:0051649, GO:0071840, GO:0044699, GO:0070727, GO:0006886, GO:0016043, GO:0007005, GO:0071702, GO:0016482, GO:0006810, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0044763, GO:0072655, GO:0006839, GO:0051234, GO:0051179, GO:0051641, GO:0006996, GO:0070585, GO:0033036, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0008195 [MF]phosphatidate phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0007406 [BP]negative regulation of neuroblast proliferationprobableGO:0032502, GO:0030154, GO:0060284, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0050768, GO:0007275, GO:2000177, GO:0065007, GO:0010721, GO:0048519, GO:2000178, GO:0072091, GO:0042127, GO:0008285, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:2000647, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0008601 [MF]protein phosphatase type 2A regulator activityprobableGO:0019888, GO:0019208, GO:0003674, GO:0030234
GO:0010458 [BP]exit from mitosisprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0044763, GO:0048285, GO:0022402, GO:0007067, GO:0007049
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0043278 [BP]response to morphineprobableGO:0009719, GO:0050896, GO:0060359, GO:1901698, GO:0010033, GO:0008150, GO:0042221, GO:0043279, GO:0014072, GO:0010243, GO:0014070
GO:0045201 [BP]maintenance of neuroblast polarityprobableGO:0055059, GO:0030154, GO:0055057, GO:0045196, GO:0048103, GO:0007163, GO:0030011, GO:0007405, GO:0051301, GO:0048869, GO:0007275, GO:0044699, GO:0061351, GO:0032502, GO:0032501, GO:0008283, GO:0009987, GO:0044763, GO:0048731, GO:0022008, GO:0017145, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0072089
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030182 [BP]neuron differentiationprobableGO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0043653 [BP]mitochondrial fragmentation involved in apoptotic processprobableGO:0006996, GO:0010259, GO:0008637, GO:0009987, GO:0000266, GO:0044699, GO:0071840, GO:0006915, GO:0016043, GO:0012501, GO:0044763, GO:0048285, GO:0008150, GO:0007569, GO:0007005
GO:0000090 [BP]mitotic anaphaseprobableGO:0006996, GO:0044699, GO:0000279, GO:0000278, GO:0051322, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007067, GO:0007049, GO:0048285
GO:0033554 [BP]cellular response to stressprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0005934 [CC]cellular bud tipprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0005935 [CC]cellular bud neckprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0007423 [BP]sensory organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0001700 [BP]embryonic development via the syncytial blastodermprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0007275, GO:0044699
GO:0005741 [CC]mitochondrial outer membraneprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0000184 [BP]nuclear-transcribed mRNA catabolic process, nonsense-mediated decayprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0010467 [BP]gene expressionprobableGO:0071704, GO:0008150, GO:0008152, GO:0043170

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DW8, chain B
Confidence level:very confident
Coverage over the Query: 2-106
View the alignment between query and template
View the model in PyMOL