Psyllid ID: psy13887
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| 328783306 | 469 | PREDICTED: protein phosphatase PP2A 55 k | 0.934 | 0.213 | 0.92 | 4e-49 | |
| 383858543 | 469 | PREDICTED: protein phosphatase PP2A 55 k | 0.934 | 0.213 | 0.92 | 4e-49 | |
| 340725467 | 469 | PREDICTED: protein phosphatase PP2A 55 k | 0.934 | 0.213 | 0.92 | 4e-49 | |
| 383858541 | 467 | PREDICTED: protein phosphatase PP2A 55 k | 0.934 | 0.214 | 0.92 | 5e-49 | |
| 380024701 | 479 | PREDICTED: protein phosphatase PP2A 55 k | 0.934 | 0.208 | 0.92 | 5e-49 | |
| 307186493 | 448 | Protein phosphatase PP2A 55 kDa regulato | 0.934 | 0.223 | 0.92 | 6e-49 | |
| 332023070 | 448 | Protein phosphatase PP2A 55 kDa regulato | 0.934 | 0.223 | 0.92 | 7e-49 | |
| 345490872 | 494 | PREDICTED: protein phosphatase PP2A 55 k | 0.934 | 0.202 | 0.9 | 1e-48 | |
| 345490868 | 448 | PREDICTED: protein phosphatase PP2A 55 k | 0.934 | 0.223 | 0.9 | 2e-48 | |
| 156538759 | 501 | PREDICTED: protein phosphatase PP2A 55 k | 0.934 | 0.199 | 0.9 | 2e-48 |
| >gi|328783306|ref|XP_394082.3| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
Score = 198 bits (503), Expect = 4e-49, Method: Compositional matrix adjust.
Identities = 92/100 (92%), Positives = 95/100 (95%)
Query: 7 VHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAARE 66
VHEYLRSKLCSLYENDCIFDKFE CWSG DSAIMTGSYNNFFR+FDR KRD TLEAAR+
Sbjct: 348 VHEYLRSKLCSLYENDCIFDKFECCWSGNDSAIMTGSYNNFFRVFDRTTKRDLTLEAARD 407
Query: 67 IAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 106
IAKPKTLL+PRKVCTGGKRKKDEISVDCLDFNKKILHTAW
Sbjct: 408 IAKPKTLLKPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 447
|
Source: Apis mellifera Species: Apis mellifera Genus: Apis Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383858543|ref|XP_003704760.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340725467|ref|XP_003401091.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 1 [Bombus terrestris] gi|340725469|ref|XP_003401092.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 2 [Bombus terrestris] gi|350415112|ref|XP_003490537.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 1 [Bombus impatiens] gi|350415115|ref|XP_003490538.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383858541|ref|XP_003704759.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380024701|ref|XP_003696131.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307186493|gb|EFN72063.1| Protein phosphatase PP2A 55 kDa regulatory subunit [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332023070|gb|EGI63335.1| Protein phosphatase PP2A 55 kDa regulatory subunit [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|345490872|ref|XP_003426484.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 4 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345490868|ref|XP_003426482.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|156538759|ref|XP_001607887.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| FB|FBgn0004889 | 499 | tws "twins" [Drosophila melano | 0.934 | 0.200 | 0.85 | 7.9e-46 | |
| ZFIN|ZDB-GENE-040426-2086 | 447 | ppp2r2d "protein phosphatase 2 | 0.943 | 0.225 | 0.851 | 1.6e-45 | |
| ZFIN|ZDB-GENE-070424-128 | 448 | si:ch211-136d9.1 "si:ch211-136 | 0.943 | 0.225 | 0.851 | 1.6e-45 | |
| UNIPROTKB|J9P487 | 422 | PPP2R2D "Uncharacterized prote | 0.943 | 0.239 | 0.861 | 2.1e-45 | |
| UNIPROTKB|Q6DIY3 | 447 | ppp2r2d "Serine/threonine-prot | 0.943 | 0.225 | 0.841 | 3.4e-45 | |
| MGI|MGI:1289252 | 453 | Ppp2r2d "protein phosphatase 2 | 0.943 | 0.222 | 0.851 | 4.4e-45 | |
| UNIPROTKB|Q66LE6 | 453 | PPP2R2D "Serine/threonine-prot | 0.943 | 0.222 | 0.841 | 7.1e-45 | |
| UNIPROTKB|F1NNN2 | 450 | PPP2R2D "Serine/threonine-prot | 0.943 | 0.224 | 0.831 | 9.1e-45 | |
| UNIPROTKB|F1NS69 | 451 | PPP2R2D "Serine/threonine-prot | 0.943 | 0.223 | 0.831 | 9.1e-45 | |
| UNIPROTKB|Q5ZIY5 | 451 | PPP2R2D "Serine/threonine-prot | 0.943 | 0.223 | 0.831 | 9.1e-45 |
| FB|FBgn0004889 tws "twins" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 481 (174.4 bits), Expect = 7.9e-46, P = 7.9e-46
Identities = 85/100 (85%), Positives = 95/100 (95%)
Query: 7 VHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAARE 66
VHEYLR+KLCSLYENDCIFDKFE CW+G DS+IMTGSYNNFFR+FDR +K+D TLEA+R+
Sbjct: 378 VHEYLRAKLCSLYENDCIFDKFECCWNGKDSSIMTGSYNNFFRVFDRNSKKDVTLEASRD 437
Query: 67 IAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 106
I KPKT+L+PRKVCTGGKRKKDEISVDCLDFNKKILHTAW
Sbjct: 438 IIKPKTVLKPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 477
|
|
| ZFIN|ZDB-GENE-040426-2086 ppp2r2d "protein phosphatase 2, regulatory subunit B, delta" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070424-128 si:ch211-136d9.1 "si:ch211-136d9.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P487 PPP2R2D "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6DIY3 ppp2r2d "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1289252 Ppp2r2d "protein phosphatase 2, regulatory subunit B, delta isoform" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q66LE6 PPP2R2D "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NNN2 PPP2R2D "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NS69 PPP2R2D "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZIY5 PPP2R2D "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 107 | |||
| COG5170 | 460 | COG5170, CDC55, Serine/threonine protein phosphata | 1e-14 |
| >gnl|CDD|227498 COG5170, CDC55, Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Score = 67.7 bits (165), Expect = 1e-14
Identities = 36/120 (30%), Positives = 56/120 (46%), Gaps = 20/120 (16%)
Query: 7 VHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMF--------DR---IN 55
+H L +L +YEND IFDKFE+ +SG D +++GSY+N F ++ D +N
Sbjct: 320 MHCDLMDELNDVYENDAIFDKFEISFSGDDKHVLSGSYSNNFGIYPTDSSGFKDVGHVVN 379
Query: 56 KRDATLEAAREIAKPKTLLRPRKVCTGGKRKKDEIS---------VDCLDFNKKILHTAW 106
D + E + + + + K+ R + D LD KKILH +W
Sbjct: 380 LADGSAEDFKVKCETNNVEKKDKLKNNDWRSVSSSADGFVVACEDPDNLDLLKKILHRSW 439
|
Length = 460 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| KOG1354|consensus | 433 | 100.0 | ||
| COG5170 | 460 | CDC55 Serine/threonine protein phosphatase 2A, reg | 99.94 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 97.55 | |
| KOG2394|consensus | 636 | 97.12 | ||
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 95.91 | |
| KOG0266|consensus | 456 | 94.79 | ||
| KOG1446|consensus | 311 | 94.71 | ||
| KOG0288|consensus | 459 | 94.63 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 94.31 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 94.28 | |
| KOG0315|consensus | 311 | 94.22 | ||
| KOG0271|consensus | 480 | 94.1 | ||
| KOG0273|consensus | 524 | 94.02 | ||
| KOG0272|consensus | 459 | 93.9 | ||
| KOG0313|consensus | 423 | 93.63 | ||
| KOG0266|consensus | 456 | 93.52 | ||
| KOG0299|consensus | 479 | 93.49 | ||
| KOG0291|consensus | 893 | 92.6 | ||
| KOG0284|consensus | 464 | 92.54 | ||
| KOG0275|consensus | 508 | 92.33 | ||
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 92.0 | |
| PTZ00421 | 493 | coronin; Provisional | 91.21 | |
| KOG0647|consensus | 347 | 91.1 | ||
| KOG0279|consensus | 315 | 91.05 | ||
| KOG0272|consensus | 459 | 90.9 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 90.76 | |
| KOG0271|consensus | 480 | 90.56 | ||
| KOG0283|consensus | 712 | 90.32 | ||
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 90.19 | |
| KOG0310|consensus | 487 | 90.05 | ||
| KOG0268|consensus | 433 | 89.64 | ||
| KOG0313|consensus | 423 | 89.44 | ||
| KOG0645|consensus | 312 | 89.09 | ||
| KOG0282|consensus | 503 | 88.47 | ||
| PTZ00421 | 493 | coronin; Provisional | 87.78 | |
| KOG0973|consensus | 942 | 87.23 | ||
| KOG1274|consensus | 933 | 86.99 | ||
| KOG2919|consensus | 406 | 86.72 | ||
| KOG1009|consensus | 434 | 86.63 | ||
| KOG2394|consensus | 636 | 86.35 | ||
| KOG0279|consensus | 315 | 86.19 | ||
| KOG0273|consensus | 524 | 85.57 | ||
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 85.19 | |
| KOG0293|consensus | 519 | 85.1 | ||
| KOG0318|consensus | 603 | 85.0 | ||
| KOG0318|consensus | 603 | 84.8 | ||
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 84.73 | |
| PF14727 | 418 | PHTB1_N: PTHB1 N-terminus | 84.63 | |
| PTZ00420 | 568 | coronin; Provisional | 84.38 | |
| PF07676 | 39 | PD40: WD40-like Beta Propeller Repeat; InterPro: I | 83.96 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 83.41 | |
| KOG4328|consensus | 498 | 83.03 | ||
| PTZ00420 | 568 | coronin; Provisional | 82.46 | |
| KOG0286|consensus | 343 | 81.23 | ||
| KOG0280|consensus | 339 | 80.37 | ||
| KOG2096|consensus | 420 | 80.06 |
| >KOG1354|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.9e-46 Score=306.07 Aligned_cols=105 Identities=68% Similarity=1.076 Sum_probs=102.9
Q ss_pred CCcccchHHHHHhhhhhhhccccccceeeEEcCCCCeEEecccCCeEEEee--cCCCcceeEeeeccccCccccCCCcce
Q psy13887 2 FPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFD--RINKRDATLEAAREIAKPKTLLRPRKV 79 (107)
Q Consensus 2 v~t~~vhe~Lr~kLcdLYEND~IFDKFec~~sgd~~~v~TGSYnn~F~ifd--~~~~~~~~LeAsk~~~k~k~~~~~~~~ 79 (107)
|+|||||||||+|||+|||||||||||||||||++++||||||||+||||+ +++.++++|||++++.++++++++++|
T Consensus 307 v~t~~vh~~lr~kLc~lYEnD~IfdKFec~~sg~~~~v~TGsy~n~frvf~~~~gsk~d~tl~asr~~~~~~~~~k~~~V 386 (433)
T KOG1354|consen 307 VETYPVHEYLRSKLCSLYENDAIFDKFECSWSGNDSYVMTGSYNNVFRVFNLARGSKEDFTLEASRKNMKPRKVLKLRLV 386 (433)
T ss_pred ceEEeehHhHHHHHHHHhhccchhheeEEEEcCCcceEecccccceEEEecCCCCcceeecccccccCCcccccccceee
Confidence 789999999999999999999999999999999999999999999999999 778899999999999999999999999
Q ss_pred eeCCCCCCCCCCCCCCcccccccccCC
Q psy13887 80 CTGGKRKKDEISVDCLDFNKKILHTAW 106 (107)
Q Consensus 80 ~~~~~~~~~~~~~d~~DF~kKILH~aW 106 (107)
+.+|+|+++++++|++||++||||+||
T Consensus 387 ~~~g~r~~~~~~vd~ldf~kkilh~aW 413 (433)
T KOG1354|consen 387 SSSGKRKRDEISVDALDFRKKILHTAW 413 (433)
T ss_pred ecCCCccccccccchhhhhhHHHhhcc
Confidence 999999999999999999999999999
|
|
| >COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG2394|consensus | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG1446|consensus | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0315|consensus | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >KOG0313|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG0299|consensus | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >KOG0275|consensus | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0647|consensus | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >KOG0283|consensus | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0310|consensus | Back alignment and domain information |
|---|
| >KOG0268|consensus | Back alignment and domain information |
|---|
| >KOG0313|consensus | Back alignment and domain information |
|---|
| >KOG0645|consensus | Back alignment and domain information |
|---|
| >KOG0282|consensus | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0973|consensus | Back alignment and domain information |
|---|
| >KOG1274|consensus | Back alignment and domain information |
|---|
| >KOG2919|consensus | Back alignment and domain information |
|---|
| >KOG1009|consensus | Back alignment and domain information |
|---|
| >KOG2394|consensus | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0293|consensus | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >PF14727 PHTB1_N: PTHB1 N-terminus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG4328|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0286|consensus | Back alignment and domain information |
|---|
| >KOG0280|consensus | Back alignment and domain information |
|---|
| >KOG2096|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 107 | ||||
| 3dw8_B | 447 | Structure Of A Protein Phosphatase 2a Holoenzyme Wi | 1e-47 |
| >pdb|3DW8|B Chain B, Structure Of A Protein Phosphatase 2a Holoenzyme With B55 Subunit Length = 447 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 107 | |||
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 1e-34 |
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 | Back alignment and structure |
|---|
Score = 122 bits (306), Expect = 1e-34
Identities = 84/101 (83%), Positives = 91/101 (90%)
Query: 6 QVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAR 65
QVHEYLRSKLCSLYENDCIFDKFE CW+G+DS +MTGSYNNFFRMFDR KRD TLEA+R
Sbjct: 324 QVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASR 383
Query: 66 EIAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 106
E KP+T+L+PRKVC GKRKKDEISVD LDFNKKILHTAW
Sbjct: 384 ENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAW 424
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 99.77 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 96.69 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 96.39 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 96.21 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 96.12 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 96.0 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 95.97 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 95.95 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 95.88 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 95.71 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 95.66 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 95.6 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 95.53 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 95.46 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 95.43 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 95.33 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 95.28 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 95.22 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 95.12 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 95.11 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 95.08 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 95.04 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 94.97 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 94.97 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 94.97 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 94.97 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 94.95 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 94.93 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 94.93 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 94.92 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 94.89 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 94.89 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 94.88 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 94.86 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 94.83 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 94.79 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 94.69 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 94.68 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 94.62 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 94.6 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 94.59 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 94.57 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 94.48 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 94.36 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 94.33 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 94.31 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 94.31 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 94.3 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 94.27 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 94.27 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 94.24 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 94.23 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 94.22 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 94.17 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 94.15 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 94.05 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 94.03 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 93.97 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 93.9 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 93.88 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 93.87 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 93.86 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 93.84 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 93.83 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 93.81 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 93.78 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 93.73 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 93.72 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 93.68 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 93.62 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 93.42 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 93.41 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 93.29 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 93.12 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 93.0 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 92.92 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 92.9 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 92.87 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 92.84 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 92.79 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 92.71 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 92.63 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 92.62 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 92.6 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 92.57 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 92.48 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 92.47 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 92.45 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 92.41 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 92.31 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 92.06 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 92.05 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 92.03 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 91.95 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 91.87 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 91.81 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 91.76 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 91.6 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 91.58 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 91.55 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 91.12 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 91.06 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 90.98 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 90.83 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 90.35 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 90.31 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 90.23 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 90.15 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 90.15 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 90.09 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 89.46 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 89.2 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 89.2 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 89.13 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 89.01 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 88.97 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 88.66 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 88.4 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 88.4 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 88.01 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 87.59 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 87.56 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 87.53 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 87.13 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 86.95 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 85.71 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 85.67 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 85.55 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 85.52 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 85.32 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 84.91 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 84.52 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 84.47 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 83.97 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 83.51 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 82.94 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 82.68 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 82.37 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 80.76 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 80.33 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 80.29 |
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.77 E-value=4.1e-19 Score=133.37 Aligned_cols=105 Identities=80% Similarity=1.332 Sum_probs=99.6
Q ss_pred CCcccchHHHHHhhhhhhhccccccceeeEEcCCCCeEEecccCCeEEEeecCCCcceeEeeeccccCccccCCCcceee
Q psy13887 2 FPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAREIAKPKTLLRPRKVCT 81 (107)
Q Consensus 2 v~t~~vhe~Lr~kLcdLYEND~IFDKFec~~sgd~~~v~TGSYnn~F~ifd~~~~~~~~LeAsk~~~k~k~~~~~~~~~~ 81 (107)
+.++..|+.++.+||++|++||||+.|.++|||||++++|||.++.++||+..++..++||+.+++.+++....+++++.
T Consensus 320 ~~~~~~~~~~~~~l~~~~~~~~i~~~~~~~~s~~~~~l~s~s~dg~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 399 (447)
T 3dw8_B 320 VETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCA 399 (447)
T ss_dssp SCCEESCGGGTTTHHHHHHTSGGGCCCCEEECTTSSEEEEECSTTEEEEEETTTCCEEEEECCSTTCCTTCBCCCCCEEC
T ss_pred cceeeccccccccccccccccccccceEEEECCCCCEEEEeccCCEEEEEEcCCCcceeeeecccccccccccCCccccc
Confidence 57889999999999999999999999999999999999999999999999999999999999999999998888988888
Q ss_pred CCCCCCCCCCCCCCcccccccccCC
Q psy13887 82 GGKRKKDEISVDCLDFNKKILHTAW 106 (107)
Q Consensus 82 ~~~~~~~~~~~d~~DF~kKILH~aW 106 (107)
++++.+.++..+.+||+++|++++|
T Consensus 400 ~~~~~~~~~~~~~~~~~~~i~~~~~ 424 (447)
T 3dw8_B 400 SGKRKKDEISVDSLDFNKKILHTAW 424 (447)
T ss_dssp SSCCCTTCEEGGGCCTTSCCCEEEE
T ss_pred cCCcccccccccccccCCceeEEEE
Confidence 8888888888899999999999998
|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 96.9 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 96.77 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 96.65 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.57 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 96.54 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 96.51 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 96.47 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 96.38 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 96.34 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 96.27 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 96.14 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 96.13 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 96.11 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.01 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.01 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 95.93 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 95.76 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 95.73 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 95.68 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 95.46 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 95.38 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 95.02 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 94.94 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 94.32 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 94.26 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 94.14 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 94.14 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 93.91 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 92.99 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 92.9 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 92.58 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 92.54 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 92.13 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 92.0 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 91.31 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 91.15 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 90.45 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 88.77 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 88.55 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 88.44 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 86.25 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 86.2 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 81.16 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 80.99 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 80.31 |
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: Tricorn protease domain 2 family: Tricorn protease domain 2 domain: Tricorn protease domain 2 species: Archaeon Thermoplasma acidophilum [TaxId: 2303]
Probab=96.90 E-value=0.00045 Score=47.23 Aligned_cols=39 Identities=13% Similarity=0.175 Sum_probs=32.0
Q ss_pred eeEEcCCCCeEEecccCCeEEEeecCC-CcceeEeeeccc
Q psy13887 29 EVCWSGTDSAIMTGSYNNFFRMFDRIN-KRDATLEAAREI 67 (107)
Q Consensus 29 ec~~sgd~~~v~TGSYnn~F~ifd~~~-~~~~~LeAsk~~ 67 (107)
.++|||||+++++|+-++.++||+.+. +...+|+.++.|
T Consensus 319 ~~~~SpDG~~l~~~~~Dg~i~v~d~~~~~~~~~~~~d~~~ 358 (360)
T d1k32a3 319 DLRLSADRKTVMVRKDDGKIYTFPLEKPEDERTVETDKRP 358 (360)
T ss_dssp EEEECTTSCEEEEEETTSCEEEEESSCTTSCEECCCCSSC
T ss_pred EEEECCCCCEEEEEECCCeEEEEECCCCCcceEEEecccc
Confidence 469999999999999999999999875 445667666543
|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|