Psyllid ID: psy13887


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MFPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAREIAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAWP
ccccccccHHHHHHHHHHHccccccccEEEEEccccccEEEcccccEEEEEccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccc
ccccccHHHHHHHHHHHHHHccccEccEEEEEcccccEEEEcccccEEEEEcccccccEEEEEcccccccccccccccccccccccccccccccccccHHHHHcccc
MFPSPQVHEYLRSKLCSlyendcifdkfevcwsgtdsaimtgSYNNFFRMFDRINKRDATLEAAREIakpktllrprkvctggkrkkdeiSVDCLDFNkkilhtawp
mfpspqvhEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAreiakpktllrprkvctggkrkkdeisvdcldfnkkilhtawp
MFPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAREIAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAWP
********EYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATL**********************************************
*FPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDA************************************DFNKKILHTAWP
MFPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAREIAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAWP
MFPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAR***************************DCLDFNKKILHTAWP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAREIAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAWP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query107 2.2.26 [Sep-21-2011]
Q6NY64447 Serine/threonine-protein yes N/A 0.943 0.225 0.851 5e-48
P36872499 Protein phosphatase PP2A yes N/A 0.934 0.200 0.85 8e-48
Q925E7453 Serine/threonine-protein yes N/A 0.943 0.222 0.851 1e-47
Q6DIY3447 Serine/threonine-protein yes N/A 0.943 0.225 0.841 1e-47
Q66LE6453 Serine/threonine-protein yes N/A 0.943 0.222 0.841 2e-47
Q5ZIY5451 Serine/threonine-protein yes N/A 0.943 0.223 0.831 4e-47
Q7ZX64447 Serine/threonine-protein N/A N/A 0.943 0.225 0.831 8e-47
P56932453 Serine/threonine-protein yes N/A 0.943 0.222 0.831 1e-46
Q29090426 Serine/threonine-protein yes N/A 0.943 0.237 0.831 1e-46
P36876447 Serine/threonine-protein no N/A 0.943 0.225 0.831 2e-46
>sp|Q6NY64|2ABD_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Danio rerio GN=ppp2r2d PE=2 SV=1 Back     alignment and function desciption
 Score =  189 bits (480), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 94/101 (93%)

Query: 6   QVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAR 65
           QVHEYLRSKLCSLYENDCIFDKFE CW+G+DSAIMTGSYNNFFRMFDR  +RD TLEA+R
Sbjct: 324 QVHEYLRSKLCSLYENDCIFDKFECCWNGSDSAIMTGSYNNFFRMFDRNTRRDITLEASR 383

Query: 66  EIAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 106
           E +KP+ +L+PRKVCTGGKRKKDEISVD LDFNKKILHTAW
Sbjct: 384 ESSKPRAMLKPRKVCTGGKRKKDEISVDSLDFNKKILHTAW 424




B regulatory subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit. The activity of PP2A complexes containing PPP2R2D (PR55-delta) fluctuate during the cell cycle: the activity is high in interphase and low in mitosis. During mitosis, activity of PP2A is inhibited via interaction with phosphorylated ENSA and ARPP19 inhibitors. Within the PP2A complexes, the B regulatory subunits modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.
Danio rerio (taxid: 7955)
>sp|P36872|2ABA_DROME Protein phosphatase PP2A 55 kDa regulatory subunit OS=Drosophila melanogaster GN=tws PE=2 SV=1 Back     alignment and function description
>sp|Q925E7|2ABD_MOUSE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Mus musculus GN=Ppp2r2d PE=2 SV=1 Back     alignment and function description
>sp|Q6DIY3|2ABD_XENTR Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Xenopus tropicalis GN=ppp2r2d PE=2 SV=1 Back     alignment and function description
>sp|Q66LE6|2ABD_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Homo sapiens GN=PPP2R2D PE=1 SV=1 Back     alignment and function description
>sp|Q5ZIY5|2ABD_CHICK Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Gallus gallus GN=PPP2R2D PE=2 SV=1 Back     alignment and function description
>sp|Q7ZX64|2ABD_XENLA Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Xenopus laevis GN=ppp2r2d PE=1 SV=1 Back     alignment and function description
>sp|P56932|2ABD_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Rattus norvegicus GN=Ppp2r2d PE=2 SV=1 Back     alignment and function description
>sp|Q29090|2ABA_PIG Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (Fragment) OS=Sus scrofa GN=PPP2R2A PE=2 SV=1 Back     alignment and function description
>sp|P36876|2ABA_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Rattus norvegicus GN=Ppp2r2a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
328783306 469 PREDICTED: protein phosphatase PP2A 55 k 0.934 0.213 0.92 4e-49
383858543 469 PREDICTED: protein phosphatase PP2A 55 k 0.934 0.213 0.92 4e-49
340725467 469 PREDICTED: protein phosphatase PP2A 55 k 0.934 0.213 0.92 4e-49
383858541 467 PREDICTED: protein phosphatase PP2A 55 k 0.934 0.214 0.92 5e-49
380024701 479 PREDICTED: protein phosphatase PP2A 55 k 0.934 0.208 0.92 5e-49
307186493 448 Protein phosphatase PP2A 55 kDa regulato 0.934 0.223 0.92 6e-49
332023070 448 Protein phosphatase PP2A 55 kDa regulato 0.934 0.223 0.92 7e-49
345490872 494 PREDICTED: protein phosphatase PP2A 55 k 0.934 0.202 0.9 1e-48
345490868 448 PREDICTED: protein phosphatase PP2A 55 k 0.934 0.223 0.9 2e-48
156538759 501 PREDICTED: protein phosphatase PP2A 55 k 0.934 0.199 0.9 2e-48
>gi|328783306|ref|XP_394082.3| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit isoform 1 [Apis mellifera] Back     alignment and taxonomy information
 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 92/100 (92%), Positives = 95/100 (95%)

Query: 7   VHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAARE 66
           VHEYLRSKLCSLYENDCIFDKFE CWSG DSAIMTGSYNNFFR+FDR  KRD TLEAAR+
Sbjct: 348 VHEYLRSKLCSLYENDCIFDKFECCWSGNDSAIMTGSYNNFFRVFDRTTKRDLTLEAARD 407

Query: 67  IAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 106
           IAKPKTLL+PRKVCTGGKRKKDEISVDCLDFNKKILHTAW
Sbjct: 408 IAKPKTLLKPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 447




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383858543|ref|XP_003704760.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340725467|ref|XP_003401091.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 1 [Bombus terrestris] gi|340725469|ref|XP_003401092.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 2 [Bombus terrestris] gi|350415112|ref|XP_003490537.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 1 [Bombus impatiens] gi|350415115|ref|XP_003490538.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|383858541|ref|XP_003704759.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380024701|ref|XP_003696131.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like [Apis florea] Back     alignment and taxonomy information
>gi|307186493|gb|EFN72063.1| Protein phosphatase PP2A 55 kDa regulatory subunit [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332023070|gb|EGI63335.1| Protein phosphatase PP2A 55 kDa regulatory subunit [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345490872|ref|XP_003426484.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 4 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345490868|ref|XP_003426482.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156538759|ref|XP_001607887.1| PREDICTED: protein phosphatase PP2A 55 kDa regulatory subunit-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
FB|FBgn0004889499 tws "twins" [Drosophila melano 0.934 0.200 0.85 7.9e-46
ZFIN|ZDB-GENE-040426-2086447 ppp2r2d "protein phosphatase 2 0.943 0.225 0.851 1.6e-45
ZFIN|ZDB-GENE-070424-128448 si:ch211-136d9.1 "si:ch211-136 0.943 0.225 0.851 1.6e-45
UNIPROTKB|J9P487422 PPP2R2D "Uncharacterized prote 0.943 0.239 0.861 2.1e-45
UNIPROTKB|Q6DIY3447 ppp2r2d "Serine/threonine-prot 0.943 0.225 0.841 3.4e-45
MGI|MGI:1289252453 Ppp2r2d "protein phosphatase 2 0.943 0.222 0.851 4.4e-45
UNIPROTKB|Q66LE6453 PPP2R2D "Serine/threonine-prot 0.943 0.222 0.841 7.1e-45
UNIPROTKB|F1NNN2450 PPP2R2D "Serine/threonine-prot 0.943 0.224 0.831 9.1e-45
UNIPROTKB|F1NS69451 PPP2R2D "Serine/threonine-prot 0.943 0.223 0.831 9.1e-45
UNIPROTKB|Q5ZIY5451 PPP2R2D "Serine/threonine-prot 0.943 0.223 0.831 9.1e-45
FB|FBgn0004889 tws "twins" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 481 (174.4 bits), Expect = 7.9e-46, P = 7.9e-46
 Identities = 85/100 (85%), Positives = 95/100 (95%)

Query:     7 VHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAARE 66
             VHEYLR+KLCSLYENDCIFDKFE CW+G DS+IMTGSYNNFFR+FDR +K+D TLEA+R+
Sbjct:   378 VHEYLRAKLCSLYENDCIFDKFECCWNGKDSSIMTGSYNNFFRVFDRNSKKDVTLEASRD 437

Query:    67 IAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 106
             I KPKT+L+PRKVCTGGKRKKDEISVDCLDFNKKILHTAW
Sbjct:   438 IIKPKTVLKPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 477




GO:0007088 "regulation of mitosis" evidence=IMP
GO:0000090 "mitotic anaphase" evidence=IMP
GO:0007447 "imaginal disc pattern formation" evidence=IMP
GO:0006470 "protein dephosphorylation" evidence=ISS;NAS
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
GO:0000159 "protein phosphatase type 2A complex" evidence=IEA;ISS;NAS
GO:0007423 "sensory organ development" evidence=IMP
GO:0008601 "protein phosphatase type 2A regulator activity" evidence=NAS;IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0001700 "embryonic development via the syncytial blastoderm" evidence=IMP
GO:0016055 "Wnt receptor signaling pathway" evidence=IGI;IMP
GO:0000278 "mitotic cell cycle" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0051297 "centrosome organization" evidence=IMP
GO:0045201 "maintenance of neuroblast polarity" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0007406 "negative regulation of neuroblast proliferation" evidence=IMP
ZFIN|ZDB-GENE-040426-2086 ppp2r2d "protein phosphatase 2, regulatory subunit B, delta" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-128 si:ch211-136d9.1 "si:ch211-136d9.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9P487 PPP2R2D "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DIY3 ppp2r2d "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
MGI|MGI:1289252 Ppp2r2d "protein phosphatase 2, regulatory subunit B, delta isoform" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q66LE6 PPP2R2D "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNN2 PPP2R2D "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NS69 PPP2R2D "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIY5 PPP2R2D "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6DIY32ABD_XENTRNo assigned EC number0.84150.94390.2259yesN/A
P368722ABA_DROMENo assigned EC number0.850.93450.2004yesN/A
Q290902ABA_PIGNo assigned EC number0.83160.94390.2370yesN/A
Q66LE62ABD_HUMANNo assigned EC number0.84150.94390.2229yesN/A
P569322ABD_RATNo assigned EC number0.83160.94390.2229yesN/A
P631502ABA_RABITNo assigned EC number0.83160.94390.2259yesN/A
Q5ZIY52ABD_CHICKNo assigned EC number0.83160.94390.2239yesN/A
Q003622ABA_YEASTNo assigned EC number0.53060.45790.0931yesN/A
Q6NY642ABD_DANRENo assigned EC number0.85140.94390.2259yesN/A
Q925E72ABD_MOUSENo assigned EC number0.85140.94390.2229yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
COG5170460 COG5170, CDC55, Serine/threonine protein phosphata 1e-14
>gnl|CDD|227498 COG5170, CDC55, Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
 Score = 67.7 bits (165), Expect = 1e-14
 Identities = 36/120 (30%), Positives = 56/120 (46%), Gaps = 20/120 (16%)

Query: 7   VHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMF--------DR---IN 55
           +H  L  +L  +YEND IFDKFE+ +SG D  +++GSY+N F ++        D    +N
Sbjct: 320 MHCDLMDELNDVYENDAIFDKFEISFSGDDKHVLSGSYSNNFGIYPTDSSGFKDVGHVVN 379

Query: 56  KRDATLEAAREIAKPKTLLRPRKVCTGGKRKKDEIS---------VDCLDFNKKILHTAW 106
             D + E  +   +   + +  K+     R     +          D LD  KKILH +W
Sbjct: 380 LADGSAEDFKVKCETNNVEKKDKLKNNDWRSVSSSADGFVVACEDPDNLDLLKKILHRSW 439


Length = 460

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
KOG1354|consensus433 100.0
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.94
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.55
KOG2394|consensus 636 97.12
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.91
KOG0266|consensus456 94.79
KOG1446|consensus311 94.71
KOG0288|consensus459 94.63
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 94.31
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 94.28
KOG0315|consensus311 94.22
KOG0271|consensus 480 94.1
KOG0273|consensus 524 94.02
KOG0272|consensus459 93.9
KOG0313|consensus 423 93.63
KOG0266|consensus 456 93.52
KOG0299|consensus 479 93.49
KOG0291|consensus 893 92.6
KOG0284|consensus 464 92.54
KOG0275|consensus 508 92.33
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 92.0
PTZ00421 493 coronin; Provisional 91.21
KOG0647|consensus 347 91.1
KOG0279|consensus 315 91.05
KOG0272|consensus459 90.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 90.76
KOG0271|consensus480 90.56
KOG0283|consensus 712 90.32
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 90.19
KOG0310|consensus 487 90.05
KOG0268|consensus433 89.64
KOG0313|consensus 423 89.44
KOG0645|consensus 312 89.09
KOG0282|consensus 503 88.47
PTZ00421 493 coronin; Provisional 87.78
KOG0973|consensus 942 87.23
KOG1274|consensus 933 86.99
KOG2919|consensus 406 86.72
KOG1009|consensus 434 86.63
KOG2394|consensus 636 86.35
KOG0279|consensus 315 86.19
KOG0273|consensus524 85.57
PLN00181793 protein SPA1-RELATED; Provisional 85.19
KOG0293|consensus 519 85.1
KOG0318|consensus603 85.0
KOG0318|consensus 603 84.8
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 84.73
PF14727 418 PHTB1_N: PTHB1 N-terminus 84.63
PTZ00420 568 coronin; Provisional 84.38
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 83.96
PLN00181 793 protein SPA1-RELATED; Provisional 83.41
KOG4328|consensus498 83.03
PTZ00420 568 coronin; Provisional 82.46
KOG0286|consensus343 81.23
KOG0280|consensus339 80.37
KOG2096|consensus420 80.06
>KOG1354|consensus Back     alignment and domain information
Probab=100.00  E-value=7.9e-46  Score=306.07  Aligned_cols=105  Identities=68%  Similarity=1.076  Sum_probs=102.9

Q ss_pred             CCcccchHHHHHhhhhhhhccccccceeeEEcCCCCeEEecccCCeEEEee--cCCCcceeEeeeccccCccccCCCcce
Q psy13887          2 FPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFD--RINKRDATLEAAREIAKPKTLLRPRKV   79 (107)
Q Consensus         2 v~t~~vhe~Lr~kLcdLYEND~IFDKFec~~sgd~~~v~TGSYnn~F~ifd--~~~~~~~~LeAsk~~~k~k~~~~~~~~   79 (107)
                      |+|||||||||+|||+|||||||||||||||||++++||||||||+||||+  +++.++++|||++++.++++++++++|
T Consensus       307 v~t~~vh~~lr~kLc~lYEnD~IfdKFec~~sg~~~~v~TGsy~n~frvf~~~~gsk~d~tl~asr~~~~~~~~~k~~~V  386 (433)
T KOG1354|consen  307 VETYPVHEYLRSKLCSLYENDAIFDKFECSWSGNDSYVMTGSYNNVFRVFNLARGSKEDFTLEASRKNMKPRKVLKLRLV  386 (433)
T ss_pred             ceEEeehHhHHHHHHHHhhccchhheeEEEEcCCcceEecccccceEEEecCCCCcceeecccccccCCcccccccceee
Confidence            789999999999999999999999999999999999999999999999999  778899999999999999999999999


Q ss_pred             eeCCCCCCCCCCCCCCcccccccccCC
Q psy13887         80 CTGGKRKKDEISVDCLDFNKKILHTAW  106 (107)
Q Consensus        80 ~~~~~~~~~~~~~d~~DF~kKILH~aW  106 (107)
                      +.+|+|+++++++|++||++||||+||
T Consensus       387 ~~~g~r~~~~~~vd~ldf~kkilh~aW  413 (433)
T KOG1354|consen  387 SSSGKRKRDEISVDALDFRKKILHTAW  413 (433)
T ss_pred             ecCCCccccccccchhhhhhHHHhhcc
Confidence            999999999999999999999999999



>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
3dw8_B447 Structure Of A Protein Phosphatase 2a Holoenzyme Wi 1e-47
>pdb|3DW8|B Chain B, Structure Of A Protein Phosphatase 2a Holoenzyme With B55 Subunit Length = 447 Back     alignment and structure

Iteration: 1

Score = 184 bits (466), Expect = 1e-47, Method: Compositional matrix adjust. Identities = 84/101 (83%), Positives = 91/101 (90%) Query: 6 QVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAR 65 QVHEYLRSKLCSLYENDCIFDKFE CW+G+DS +MTGSYNNFFRMFDR KRD TLEA+R Sbjct: 324 QVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASR 383 Query: 66 EIAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 106 E KP+T+L+PRKVC GKRKKDEISVD LDFNKKILHTAW Sbjct: 384 ENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAW 424

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 1e-34
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
 Score =  122 bits (306), Expect = 1e-34
 Identities = 84/101 (83%), Positives = 91/101 (90%)

Query: 6   QVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAR 65
           QVHEYLRSKLCSLYENDCIFDKFE CW+G+DS +MTGSYNNFFRMFDR  KRD TLEA+R
Sbjct: 324 QVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASR 383

Query: 66  EIAKPKTLLRPRKVCTGGKRKKDEISVDCLDFNKKILHTAW 106
           E  KP+T+L+PRKVC  GKRKKDEISVD LDFNKKILHTAW
Sbjct: 384 ENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAW 424


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.77
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.69
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.39
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 96.21
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 96.12
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.97
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 95.88
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 95.71
2pm7_B 297 Protein transport protein SEC13, protein transport 95.66
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.6
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 95.53
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 95.46
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 95.43
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.33
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 95.28
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.22
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 95.12
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 95.11
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.08
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 95.04
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 94.97
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.97
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 94.97
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 94.97
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.95
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 94.93
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 94.93
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 94.92
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 94.89
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 94.89
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.88
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 94.86
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 94.83
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 94.79
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 94.69
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 94.68
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 94.62
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 94.6
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.59
4e54_B435 DNA damage-binding protein 2; beta barrel, double 94.57
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.48
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 94.36
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 94.33
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 94.31
3ow8_A321 WD repeat-containing protein 61; structural genomi 94.31
3jrp_A 379 Fusion protein of protein transport protein SEC13 94.3
3ow8_A321 WD repeat-containing protein 61; structural genomi 94.27
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.27
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 94.24
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 94.23
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 94.22
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 94.17
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 94.15
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.05
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 94.03
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 93.97
2pm7_B297 Protein transport protein SEC13, protein transport 93.9
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 93.88
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 93.87
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 93.86
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 93.84
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 93.83
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 93.81
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 93.78
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 93.73
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 93.72
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 93.68
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 93.62
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 93.42
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 93.41
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 93.29
3jrp_A379 Fusion protein of protein transport protein SEC13 93.12
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 93.0
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 92.92
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 92.9
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 92.87
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 92.84
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 92.79
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 92.71
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 92.63
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 92.62
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 92.6
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 92.57
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 92.48
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 92.47
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 92.45
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 92.41
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 92.31
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 92.06
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.05
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 92.03
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 91.95
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.87
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 91.81
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 91.76
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 91.6
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 91.58
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 91.55
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 91.12
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 91.06
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 90.98
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 90.83
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 90.35
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 90.31
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 90.23
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 90.15
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 90.15
2xyi_A430 Probable histone-binding protein CAF1; transcripti 90.09
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 89.46
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 89.2
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 89.2
3jro_A 753 Fusion protein of protein transport protein SEC13 89.13
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 89.01
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 88.97
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 88.66
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 88.4
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 88.4
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 88.01
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 87.59
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 87.56
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 87.53
3jro_A 753 Fusion protein of protein transport protein SEC13 87.13
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 86.95
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 85.71
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 85.67
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 85.55
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 85.52
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 85.32
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 84.91
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 84.52
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 84.47
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 83.97
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 83.51
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 82.94
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 82.68
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 82.37
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 80.76
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 80.33
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 80.29
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
Probab=99.77  E-value=4.1e-19  Score=133.37  Aligned_cols=105  Identities=80%  Similarity=1.332  Sum_probs=99.6

Q ss_pred             CCcccchHHHHHhhhhhhhccccccceeeEEcCCCCeEEecccCCeEEEeecCCCcceeEeeeccccCccccCCCcceee
Q psy13887          2 FPSPQVHEYLRSKLCSLYENDCIFDKFEVCWSGTDSAIMTGSYNNFFRMFDRINKRDATLEAAREIAKPKTLLRPRKVCT   81 (107)
Q Consensus         2 v~t~~vhe~Lr~kLcdLYEND~IFDKFec~~sgd~~~v~TGSYnn~F~ifd~~~~~~~~LeAsk~~~k~k~~~~~~~~~~   81 (107)
                      +.++..|+.++.+||++|++||||+.|.++|||||++++|||.++.++||+..++..++||+.+++.+++....+++++.
T Consensus       320 ~~~~~~~~~~~~~l~~~~~~~~i~~~~~~~~s~~~~~l~s~s~dg~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  399 (447)
T 3dw8_B          320 VETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCA  399 (447)
T ss_dssp             SCCEESCGGGTTTHHHHHHTSGGGCCCCEEECTTSSEEEEECSTTEEEEEETTTCCEEEEECCSTTCCTTCBCCCCCEEC
T ss_pred             cceeeccccccccccccccccccccceEEEECCCCCEEEEeccCCEEEEEEcCCCcceeeeecccccccccccCCccccc
Confidence            57889999999999999999999999999999999999999999999999999999999999999999998888988888


Q ss_pred             CCCCCCCCCCCCCCcccccccccCC
Q psy13887         82 GGKRKKDEISVDCLDFNKKILHTAW  106 (107)
Q Consensus        82 ~~~~~~~~~~~d~~DF~kKILH~aW  106 (107)
                      ++++.+.++..+.+||+++|++++|
T Consensus       400 ~~~~~~~~~~~~~~~~~~~i~~~~~  424 (447)
T 3dw8_B          400 SGKRKKDEISVDSLDFNKKILHTAW  424 (447)
T ss_dssp             SSCCCTTCEEGGGCCTTSCCCEEEE
T ss_pred             cCCcccccccccccccCCceeEEEE
Confidence            8888888888899999999999998



>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 96.9
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.77
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 96.65
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.57
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 96.54
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 96.51
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 96.47
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.38
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 96.34
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.27
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.14
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.13
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.11
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.01
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.01
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 95.93
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.76
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.73
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.68
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.46
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.38
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 95.02
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 94.94
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 94.32
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.26
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 94.14
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.14
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 93.91
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 92.99
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 92.9
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 92.58
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 92.54
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 92.13
d1pgua1 325 Actin interacting protein 1 {Baker's yeast (Saccha 92.0
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 91.31
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 91.15
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 90.45
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 88.77
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 88.55
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 88.44
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 86.25
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 86.2
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 81.16
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 80.99
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 80.31
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Tricorn protease domain 2
family: Tricorn protease domain 2
domain: Tricorn protease domain 2
species: Archaeon Thermoplasma acidophilum [TaxId: 2303]
Probab=96.90  E-value=0.00045  Score=47.23  Aligned_cols=39  Identities=13%  Similarity=0.175  Sum_probs=32.0

Q ss_pred             eeEEcCCCCeEEecccCCeEEEeecCC-CcceeEeeeccc
Q psy13887         29 EVCWSGTDSAIMTGSYNNFFRMFDRIN-KRDATLEAAREI   67 (107)
Q Consensus        29 ec~~sgd~~~v~TGSYnn~F~ifd~~~-~~~~~LeAsk~~   67 (107)
                      .++|||||+++++|+-++.++||+.+. +...+|+.++.|
T Consensus       319 ~~~~SpDG~~l~~~~~Dg~i~v~d~~~~~~~~~~~~d~~~  358 (360)
T d1k32a3         319 DLRLSADRKTVMVRKDDGKIYTFPLEKPEDERTVETDKRP  358 (360)
T ss_dssp             EEEECTTSCEEEEEETTSCEEEEESSCTTSCEECCCCSSC
T ss_pred             EEEECCCCCEEEEEECCCeEEEEECCCCCcceEEEecccc
Confidence            469999999999999999999999875 445667666543



>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure