Diaphorina citri psyllid: psy13894

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-

MVVSCLDNVCGMIPFYNVDSPDQFYRLWTSLFLHAGVIHLVISVIVQFILMRDLEKLTGSFRIAIIYFGSGIGGNLASAIFVPYRADVSCLDNVCGMIPFYNVDSPDQFYRLWTSLFLHAGARPFFTYWITTVQIIILCLSIFAYGLGPFGFNLAHNSGLVVQLEAGTTKARDDGNRTKQDMGSDLGSDPG

cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccCECHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccccccccc

MVVSCLDNVCGMIPFYNVDSPDQFYRLWTSLFLHAGVIHLVISVIVQFILMRDLEKLTGSFRIAIIYFGSGIGGNLASAIFVPYRADVSCLDNVCGMIPFYNVDSPDQFYRLWTSLFLHAGARPFFTYWITTVQIIILCLSIFAYGLGPFGFNLAHNSGLVVQLEAGTTKARDDG****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVVSCLDNVCGMIPFYNVDSPDQFYRLWTSLFLHAGVIHLVISVIVQFILMRDLEKLTGSFRIAIIYFGSGIGGNLASAIFVPYRADVSCLDNVCGMIPFYNVDSPDQFYRLWTSLFLHAGARPFFTYWITTVQIIILCLSIFAYGLGPFGFNLAHNSGLVVQLEAGTTKARDDGNRTKQDMGSDLGSDPG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Inactive rhomboid protein 1	Rhomboid protease-like protein which has no protease activity but regulates the secretion of several ligands of the epidermal growth factor receptor. Indirectly activates the epidermal growth factor receptor signaling pathway and may thereby regulate sleep, cell survival, proliferation and migration.	confident	Q76NQ1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004252 [MF]	serine-type endopeptidase activity	probable	GO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0050794 [BP]	regulation of cellular process	probable	GO:0008150, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NR9, chain A
Confidence level:confident
Coverage over the Query: 8-176
View the alignment between query and template
View the model in PyMOL