Diaphorina citri psyllid: psy13905


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MLTQVEYMDIMDGGGTVELYITNSKDKHESCLNLKKLKLNNTIGELKQKLELLTGQMSSNMTISLYNRNHDLVSHLSDNSMLLGQYPVENEMTLFVEGNYLTDGLESSETKYVLPEEKYKEHKENLKNFMMKQKEERLRREALLKENNEEKDKCLEENILKDIEVGKRCKINDSDVRFGTVMFVGETKFSSGVWVGVKLDEPFGKNNGTVKDVKYFECEENYGMFVKPGRLTIGDFPVLDPFDELDEI
cccccccccccccccEEEEEEEcccccccccccEEEccccccHHHHHHccccccccccccEEEEEEcccccEEEEcccccccccccccccccEEEEEcccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccEEEEccccccEEEEEEcccccccccEEEEEEEcccccccccEEccEEEECcccccEEEEccccEEEccccccccccccccc
***Q*EYMDIMDGGGTVELYITNSKDKHESCLNLKKLKLNNTIGELKQKLELLTGQMSSNMTISLYNRNHDLVSHLSDNSMLLGQYPVENEMTLFVEGNYLTDGL************************************************CLEENILKDIEVGKRCKINDSDVRFGTVMFVGETKFSSGVWVGVKLDEPFGKNNGTVKDVKYFECEENYGMFVKPGRLTIGDFPVLDP***LDEI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTQVEYMDIMDGGGTVELYITNSKDKHESCLNLKxxxxxxxxxxxxxxxxxxxxxMSSNMTISLYNRNHDLVSHLSDNSMLLGQYPVENEMTLFVEGNYLTDGLESSETKYVLPEEKYKEHKENLKNFMxxxxxxxxxxxxxxxxxxxxxxxCLEENILKDIEVGKRCKINDSDVRFGTVMFVGETKFSSGVWVGVKLDEPFGKNNGTVKDVKYFECEENYGMFVKPGRLTIGDFPVLDPFDELDEI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tubulin-folding cofactor B Binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. Involved in regulation of tubulin heterodimer dissociation. May function as a negative regulator of axonal growth.confidentQ99426
Tubulin-specific chaperone B Binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer.confidentQ54Z01
Tubulin-folding cofactor B Binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. Involved in regulation of tubulin heterodimer dissociation. May function as a negative regulator of axonal growth.confidentQ5E951

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0009524 [CC]phragmoplastprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0051084 [BP]'de novo' posttranslational protein foldingprobableGO:0044267, GO:0009987, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0006458, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007023 [BP]post-chaperonin tubulin folding pathwayprobableGO:0044267, GO:0072668, GO:0006457, GO:0044260, GO:0070271, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0044085, GO:0008150, GO:0008152, GO:0044238, GO:0071840
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WHG, chain A
Confidence level:very confident
Coverage over the Query: 153-240
View the alignment between query and template
View the model in PyMOL
Template: 1T0Y, chain A
Confidence level:very confident
Coverage over the Query: 15-100
View the alignment between query and template
View the model in PyMOL