Diaphorina citri psyllid: psy13922

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------51
MLPVFSLSLQVLALVSLPQLFDDPRFPDDVKQRAQAVLDGCRGQSVGSYTDSPGIEIIRRHVAQYISRRDGQPADWQDVILSAGASDGIKSVLKLLIEDVDGKKPGVLIPIPQYPLYSASLAEFNMEQIGYYLDESKQWGLPISELERSITEARKHCNPRAIVIINPGNPTGQVLTKENIQDIIKFAHREKLFLFADEVYQDNVYAEGSKFYSFKKVLVEMGEPYKSMELASFMSCSKGYMGECGLRGGYSEVINLDPGVKAMLHKSISAMLCPTVLALVSLPQLFDDPRFPDDVKQRAQAVLDGCRGQSVGQTVMDCVVNPPQPGEPSYEQFSREKQSVLDSLKQRAKMVADTFNSIEGMSCNPVQGAMYAFPQMKLPAKAIAKAKAEGKCPSVLYAFELLERTGICIVPGAGFGQVPGTYHFRQQVWWRHYTQRAIAKAKAEGKCPSVLYAFESLERTGICIVPGAGFGQVPGTYHFRTTILPQPEKLKAMLEKFREFHEEFLAKYK
ccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccccEEEccccHHHHHHHHHHHHccccccccCEEEccccccccHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHcccccccHHHHHcccccccccEEEHHHHHHHcccccccCEEEEEccccccccccccccEEEEEECcccHHHHHHHHHHHHccccccHHHHcccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccCCccccccccccccccccHHHHHHHHHccccccHHHHHHHHHccccEEEcccccccccccccEEEEEEcccccHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcc
MLPVFSLSLQVLALVSLPQLFDDPRFPDDVKQRAQAVLDGCRGQSVGSYTDSPGIEIIRRHVAQYISRRDGQPADWQDVILSAGASDGIKSVLKLLIEDVDGKKPGVLIPIPQYPLYSASLAEFNMEQIGYYLDESKQWGLPISELERSITEARKHCNPRAIVIINPGNPTGQVLTKENIQDIIKFAHREKLFLFADEVYQDNVYAEGSKFYSFKKVLVEMGEPYKSMELASFMSCSKGYMGECGLRGGYSEVINLDPGVKAMLHKSISAMLCPTVLALVSLPQLFDDPRFPDDVKQRAQAVLDGCRGQSVGQTVMDCVVNPPQPGEPSYEQFSREKQSVLDSLKQRAKMVADTFNSIEGMSCNPVQGAMYAFPQMKLPAKAIAKAKAEGKCPSVLYAFELLERTGICIVPGAGFGQVPGTYHFRQQVWWRHYTQRAIAKAKAEGKCPSVLYAFESLERTGICIVPGAGFGQVPGTYHFRTTILPQPEKLKAMLEKFREFHEEFLAK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPVFSLSLQVLALVSLPQLFDDPRFPDDVKQRAQAVLDGCRGQSVGSYTDSPGIEIIRRHVAQYISRRDGQPADWQDVILSAGASDGIKSVLKLLIEDVDGKKPGVLIPIPQYPLYSASLAEFNMEQIGYYLDESKQWGLPISELERSITEARKHCNPRAIVIINPGNPTGQVLTKENIQDIIKFAHREKLFLFADEVYQDNVYAEGSKFYSFKKVLVEMGEPYKSMELASFMSCSKGYMGECGLRGGYSEVINLDPGVKAMLHKSISAMLCPTVLALVSLPQLFDDPRFPDDVKQRAQAVLDGCRGQSVGQTVMDCVVNPPQPGEPSYEQFSREKQSVLDSLKQRAKMVADTFNSIEGMSCNPVQGAMYAFPQMKLPAKAIAKAKAEGKCPSVLYAFELLERTGICIVPGAGFGQVPGTYHFRQQVWWRHYTQRAIAKAKAEGKCPSVLYAFESLERTGICIVPGAGFGQVPGTYHFRTTILPQPEKLKAMLEKFREFHEEFLAKYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alanine aminotransferase 1 Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.confidentP24298
Alanine aminotransferase 2 Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate.confidentQ28DB5
Alanine aminotransferase 2 Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate.confidentQ8BGT5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0042851 [BP]L-alanine metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0006522, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0009078, GO:0044281, GO:0008152, GO:0043436, GO:0008150, GO:0044237, GO:1901605
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0008453 [MF]alanine-glyoxylate transaminase activityprobableGO:0008483, GO:0016740, GO:0003674, GO:0016769, GO:0003824
GO:0016020 [CC]membraneprobableGO:0005575
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0006103 [BP]2-oxoglutarate metabolic processprobableGO:0043648, GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009058 [BP]biosynthetic processprobableGO:0008150, GO:0008152
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.6.-.-Transferring nitrogenous groups.probable
2.6.1.-Transaminases (aminotransferases).probable
2.6.1.2Alanine transaminase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IHJ, chain A
Confidence level:very confident
Coverage over the Query: 4-41,52-277,312-418,466-508
View the alignment between query and template
View the model in PyMOL
Template: 3F6T, chain A
Confidence level:very confident
Coverage over the Query: 22-276,290-417,466-509
View the alignment between query and template
View the model in PyMOL
Template: 1MDO, chain A
Confidence level:confident
Coverage over the Query: 22-275,292-429,442-452,466-502
View the alignment between query and template
View the model in PyMOL