Diaphorina citri psyllid: psy13938


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MEDIEVPMPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDCKLCLYPFIFPNPLSSRVTDNGE
ccccccccccccccccccccccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHccccccccEEEEEEEccccccccEEccccccccccccccccEEEEEccccccccccCECccccccccccccccccccccccEEEEEccccccEEEECccccccHHHHHHHHHHHHHcccccccccccccEEEEEcccccccccccccccccccccccccccc
****************YNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVS*********VNAYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDCKLCLYPFIFPNPLS********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDIEVPMPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDCKLCLYPFIFPNPLSSRVTDNGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0004190 [MF]aspartic-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0070001, GO:0003824, GO:0070011, GO:0003674, GO:0008233
GO:0071310 [BP]cellular response to organic substanceprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042542 [BP]response to hydrogen peroxideprobableGO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0016485 [BP]protein processingprobableGO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0009611 [BP]response to woundingprobableGO:0006950, GO:0008150, GO:0050896
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0008631 [BP]intrinsic apoptotic signaling pathway in response to oxidative stressprobableGO:0097190, GO:0097193, GO:0023052, GO:0007165, GO:0035556, GO:0007569, GO:0050789, GO:0044699, GO:0051716, GO:0065007, GO:0010259, GO:0006915, GO:0009987, GO:0050794, GO:0012501, GO:0006950, GO:0008150, GO:0007154, GO:0006979, GO:0044700, GO:0050896, GO:0044763
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0051402 [BP]neuron apoptotic processprobableGO:0010259, GO:0009987, GO:0070997, GO:0006915, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0097285, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M72, chain A
Confidence level:very confident
Coverage over the Query: 6-144,156-233
View the alignment between query and template
View the model in PyMOL