Psyllid ID: psy13938

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MEDIEVPMPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDCKLCLYPFIFPNPLSSRVTDNGE
ccccccccccccccccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHcccccccEEEEEEEccccccccEEccccccccccccccccEEEEEccccccccccEEEccccccccccccccccccccccEEEEEccccccEEEEEccccccHHHHHHHHHHHHHcccccccccccccEEEEEcccccccccccccccccccccccccccc
cccccccccccccHHHEcccccccEEEEEEEccccccccccccccccccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHcccccccccEEEEEEcccccHHHHHHHccccccHHHccccEEEEEEcccccEcEcccccccccccccccccccccEcccccEEEEEccccccEEEEcccccccHHHHHHHHHHHHHHccccccEcccccEEEEEcccHHHHHHHHHHccccccccccccccc
medievpmpvakdsaeynmshprrgralvfnhdefqmdnmtprpgsgadvKNLEAAFYALGFEvsvytnpeFREITEILSnlsqedhsdadCLVITVLThglgeqklwlpftadkcrtlagkpKIFFIQACrgtkldggvrlvsrantetdagvnaykipsyADFLIAYSTVEDSLLACrgtkldggvrlvsrantetdagvnaykipsyADFLIAYSTVEdcklclypfifpnplssrvtdnge
medievpmpvakdsaeynmshpRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSrantetdagvnaykipSYADFLIAYSTVEDSLLACRGtkldggvrlvsrantetdagvnaykipSYADFLIAYSTVEDCKLCLYPfifpnplssrvtdnge
MEDIEVPMPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDCKLCLYPFIFPNPLSSRVTDNGE
*************************************************VKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDCKLCLYPFIFPN***********
****************YNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRL*************AYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDCKLCLYPFIFPNPLS*R******
MEDIEVPMPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDCKLCLYPFIFPNPLS********
****EVPMPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVS*********VNAYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDCKLCLYPFIFPNPLSS*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDIEVPMPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDCKLCLYPFIFPNPLSSRVTDNGE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query245 2.2.26 [Sep-21-2011]
P89116299 Caspase-1 OS=Spodoptera f N/A N/A 0.661 0.541 0.480 2e-41
O01382339 Caspase OS=Drosophila mel yes N/A 0.669 0.483 0.451 2e-38
O02002323 Caspase-1 OS=Drosophila m no N/A 0.669 0.507 0.440 3e-37
P55214303 Caspase-7 OS=Mesocricetus N/A N/A 0.673 0.544 0.392 3e-26
P55210303 Caspase-7 OS=Homo sapiens yes N/A 0.636 0.514 0.396 3e-26
O08738276 Caspase-6 OS=Mus musculus yes N/A 0.653 0.579 0.377 5e-26
Q3T0P5293 Caspase-6 OS=Bos taurus G no N/A 0.653 0.546 0.381 1e-25
Q60431277 Caspase-3 OS=Mesocricetus N/A N/A 0.608 0.537 0.393 2e-25
Q08DY9275 Caspase-3 OS=Bos taurus G no N/A 0.6 0.534 0.380 6e-25
P55212293 Caspase-6 OS=Homo sapiens no N/A 0.653 0.546 0.396 6e-25
>sp|P89116|CASP1_SPOFR Caspase-1 OS=Spodoptera frugiperda PE=1 SV=1 Back     alignment and function desciption
 Score =  169 bits (427), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (64%), Gaps = 15/177 (8%)

Query: 8   MPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVY 67
           MPV +++  YNM+H  RG A++FNH+ F + ++  R G+  D  NL      LGF+V+V+
Sbjct: 44  MPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVF 103

Query: 68  TNPEFREITEILSNLSQEDHSDADCLVITVLTHG-LG----------EQKLWLPFTADKC 116
            N +  EI + +   ++ DHSDADCL++ VLTHG LG             LW  FTADKC
Sbjct: 104 PNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKC 163

Query: 117 RTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAG-VNAYKIPSYADFLIAYSTV 172
            TLAGKPK+FFIQAC+G +LDGG+ L   + TETD     +Y+IP +ADFLIA+STV
Sbjct: 164 PTLAGKPKLFFIQACQGDRLDGGITL---SRTETDGSPSTSYRIPVHADFLIAFSTV 217
Involved in the activation cascade of caspases responsible for apoptosis execution (By similarity). Inhibited by the baculovirus anti-apoptotic protein p35. Cleaves p35 and nuclear immunophilin FKBP46.
Spodoptera frugiperda (taxid: 7108)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: -
>sp|O01382|ICE_DROME Caspase OS=Drosophila melanogaster GN=Ice PE=1 SV=2 Back     alignment and function description
>sp|O02002|CASP1_DROME Caspase-1 OS=Drosophila melanogaster GN=Dcp-1 PE=1 SV=1 Back     alignment and function description
>sp|P55214|CASP7_MESAU Caspase-7 OS=Mesocricetus auratus GN=CASP7 PE=1 SV=1 Back     alignment and function description
>sp|P55210|CASP7_HUMAN Caspase-7 OS=Homo sapiens GN=CASP7 PE=1 SV=1 Back     alignment and function description
>sp|O08738|CASP6_MOUSE Caspase-6 OS=Mus musculus GN=Casp6 PE=2 SV=1 Back     alignment and function description
>sp|Q3T0P5|CASP6_BOVIN Caspase-6 OS=Bos taurus GN=CASP6 PE=2 SV=1 Back     alignment and function description
>sp|Q60431|CASP3_MESAU Caspase-3 OS=Mesocricetus auratus GN=CASP3 PE=2 SV=1 Back     alignment and function description
>sp|Q08DY9|CASP3_BOVIN Caspase-3 OS=Bos taurus GN=CASP3 PE=2 SV=1 Back     alignment and function description
>sp|P55212|CASP6_HUMAN Caspase-6 OS=Homo sapiens GN=CASP6 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
242022291 491 Caspase-1 precursor, putative [Pediculus 0.681 0.340 0.546 1e-50
332027965 429 Caspase-1 [Acromyrmex echinatior] 0.677 0.386 0.469 3e-42
156550197 379 PREDICTED: caspase-1-like [Nasonia vitri 0.673 0.435 0.466 4e-41
58389115313 AGAP000830-PA [Anopheles gambiae str. PE 0.689 0.539 0.472 4e-41
27464915299 effector caspase [Spodoptera littoralis] 0.661 0.541 0.502 5e-41
307209306 383 Caspase [Harpegnathos saltator] 0.677 0.433 0.480 6e-41
409104072296 caspase-1 [Spodoptera litura] 0.661 0.547 0.502 7e-41
242010118290 Caspase-1 precursor, putative [Pediculus 0.661 0.558 0.482 7e-41
357613128298 caspase-1 [Danaus plexippus] 0.673 0.553 0.460 1e-40
328708695 448 PREDICTED: caspase-1-like isoform 2 [Acy 0.681 0.372 0.480 1e-40
>gi|242022291|ref|XP_002431574.1| Caspase-1 precursor, putative [Pediculus humanus corporis] gi|212516877|gb|EEB18836.1| Caspase-1 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/181 (54%), Positives = 129/181 (71%), Gaps = 14/181 (7%)

Query: 4   IEVPMPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFE 63
           +E  MPV +D+ EYNM H RRGRA++ N+D F  + ++PR GS  DV+NL   F  LGFE
Sbjct: 204 VEAVMPVDRDADEYNMYHSRRGRAIIINNDIFDNNLVSPRKGSHVDVENLTNEFTNLGFE 263

Query: 64  VSVYTNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGE------------QKLWLPF 111
           V+V++N  + +I+E ++ +S+EDHSDADCL+I VLTHG                 LW PF
Sbjct: 264 VTVFSNMPYYQISEAINEVSKEDHSDADCLMIAVLTHGFDNGYLYARDTIYSIDNLWHPF 323

Query: 112 TADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSRAN--TETDAGVNAYKIPSYADFLIAY 169
           TAD+C TLAGKPKIFF+QACRG+K+D GV LVSR    +ETDAG  AY++PS++DFLIAY
Sbjct: 324 TADRCLTLAGKPKIFFVQACRGSKVDSGVTLVSRKGSVSETDAGSAAYRLPSHSDFLIAY 383

Query: 170 S 170
           S
Sbjct: 384 S 384

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332027965|gb|EGI68016.1| Caspase-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156550197|ref|XP_001600810.1| PREDICTED: caspase-1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|58389115|ref|XP_316795.2| AGAP000830-PA [Anopheles gambiae str. PEST] gi|55238000|gb|EAA12039.2| AGAP000830-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|27464915|gb|AAO16241.1| effector caspase [Spodoptera littoralis] gi|375280375|gb|AFA43940.1| caspase-1 [Spodoptera litura] Back     alignment and taxonomy information
>gi|307209306|gb|EFN86391.1| Caspase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|409104072|dbj|BAM62940.1| caspase-1 [Spodoptera litura] Back     alignment and taxonomy information
>gi|242010118|ref|XP_002425823.1| Caspase-1 precursor, putative [Pediculus humanus corporis] gi|212509756|gb|EEB13085.1| Caspase-1 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357613128|gb|EHJ68333.1| caspase-1 [Danaus plexippus] Back     alignment and taxonomy information
>gi|328708695|ref|XP_003243774.1| PREDICTED: caspase-1-like isoform 2 [Acyrthosiphon pisum] gi|328708697|ref|XP_001950891.2| PREDICTED: caspase-1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
FB|FBgn0019972339 Ice "Ice" [Drosophila melanoga 0.669 0.483 0.451 1.3e-36
FB|FBgn0010501323 Dcp-1 "Death caspase-1" [Droso 0.669 0.507 0.457 2.4e-35
ZFIN|ZDB-GENE-041010-48569 casp6l1 "caspase 6, apoptosis- 0.640 0.275 0.412 1.2e-25
ZFIN|ZDB-GENE-050522-506316 casp7 "caspase 7, apoptosis-re 0.657 0.509 0.391 1.9e-26
UNIPROTKB|P55210303 CASP7 "Caspase-7" [Homo sapien 0.636 0.514 0.396 3.2e-26
UNIPROTKB|F1NV61271 CASP7 "Uncharacterized protein 0.636 0.575 0.395 4e-26
UNIPROTKB|G3IL63303 I79_024625 "Caspase-7" [Cricet 0.632 0.511 0.404 5.2e-26
UNIPROTKB|F1MD58277 CASP7 "Uncharacterized protein 0.636 0.563 0.396 5.2e-26
RGD|620944303 Casp7 "caspase 7" [Rattus norv 0.632 0.511 0.398 6.6e-26
UNIPROTKB|Q6AZ23277 Casp6 "Caspase 6, isoform CRA_ 0.567 0.501 0.407 1e-25
FB|FBgn0019972 Ice "Ice" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 394 (143.8 bits), Expect = 1.3e-36, P = 1.3e-36
 Identities = 80/177 (45%), Positives = 116/177 (65%)

Query:     8 MPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVY 67
             M   + +AEYNM H  RG AL+FNH+ F++  +  R G+  D +NL      L FEV+VY
Sbjct:    77 MVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVY 136

Query:    68 TNPEFREITEILSNLSQEDHSDADCLVITVLTHG-LG-------EQKL---WLPFTADKC 116
              +  +++I   +   + ++HSD+DC+++ +L+HG +G       + KL   W  FTA+ C
Sbjct:   137 KDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHC 196

Query:   117 RTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAGVN-AYKIPSYADFLIAYSTV 172
              +LAGKPK+FFIQAC+G +LDGGV +  R+ TETD   + +YKIP +ADFLIAYSTV
Sbjct:   197 PSLAGKPKLFFIQACQGDRLDGGVTM-QRSQTETDGDSSMSYKIPVHADFLIAYSTV 252
GO:0004197 "cysteine-type endopeptidase activity" evidence=ISS;IDA;TAS
GO:0006915 "apoptotic process" evidence=TAS
GO:0046668 "regulation of retinal cell programmed cell death" evidence=NAS
GO:0006508 "proteolysis" evidence=IEA;TAS
GO:0012501 "programmed cell death" evidence=IDA;IMP
GO:0048515 "spermatid differentiation" evidence=IMP
GO:0010165 "response to X-ray" evidence=IMP
GO:0035070 "salivary gland histolysis" evidence=IMP
GO:0046672 "positive regulation of compound eye retinal cell programmed cell death" evidence=IMP
GO:0010623 "developmental programmed cell death" evidence=IMP
GO:0045476 "nurse cell apoptotic process" evidence=IGI
GO:0035103 "sterol regulatory element binding protein cleavage" evidence=IDA
GO:0016322 "neuron remodeling" evidence=IMP
FB|FBgn0010501 Dcp-1 "Death caspase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-48 casp6l1 "caspase 6, apoptosis-related cysteine peptidase, like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-506 casp7 "caspase 7, apoptosis-related cysteine peptidase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P55210 CASP7 "Caspase-7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV61 CASP7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3IL63 I79_024625 "Caspase-7" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|F1MD58 CASP7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|620944 Casp7 "caspase 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AZ23 Casp6 "Caspase 6, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.220.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
cd00032243 cd00032, CASc, Caspase, interleukin-1 beta convert 3e-59
smart00115241 smart00115, CASc, Caspase, interleukin-1 beta conv 3e-50
pfam00656228 pfam00656, Peptidase_C14, Caspase domain 2e-38
>gnl|CDD|237997 cd00032, CASc, Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis) Back     alignment and domain information 
 Score =  187 bits (476), Expect = 3e-59
 Identities = 66/177 (37%), Positives = 86/177 (48%), Gaps = 18/177 (10%)

Query: 17  YNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREIT 76
           Y M+  RRG AL+ N++ F    +  R G+  D +NL   F +LG+EV V  N    EI 
Sbjct: 2   YKMNSKRRGLALIINNENF-DKGLKDRDGTDVDAENLTKLFESLGYEVEVKNNLTAEEIL 60

Query: 77  EILSNLSQEDHSDADCLVITVLTHGLGE------------QKLWLPFTADKCRTLAGKPK 124
           E L   +  DHSD+D  V  +L+HG                ++   F  D C +LAGKPK
Sbjct: 61  EELKEFASPDHSDSDSFVCVILSHGEEGGIYGTDGDVVPIDEITSLFNGDNCPSLAGKPK 120

Query: 125 IFFIQACRGTKLDGGV-----RLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDSL 176
           +FFIQACRG +LD GV                       IP  ADFL+AYSTV   +
Sbjct: 121 LFFIQACRGDELDLGVEVDSGADEPPDVETEAEDDAVQTIPVEADFLVAYSTVPGYV 177

Caspases are synthesized as inactive zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologs. Length = 243
>gnl|CDD|214521 smart00115, CASc, Caspase, interleukin-1 beta converting enzyme (ICE) homologues Back     alignment and domain information
>gnl|CDD|216047 pfam00656, Peptidase_C14, Caspase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 245
smart00115241 CASc Caspase, interleukin-1 beta converting enzyme 100.0
cd00032243 CASc Caspase, interleukin-1 beta converting enzyme 100.0
KOG3573|consensus300 99.95
PF00656248 Peptidase_C14: Caspase domain; InterPro: IPR011600 99.84
KOG3573|consensus300 98.85
smart00115241 CASc Caspase, interleukin-1 beta converting enzyme 98.42
cd00032243 CASc Caspase, interleukin-1 beta converting enzyme 98.19
COG4249 380 Uncharacterized protein containing caspase domain 98.02
KOG1546|consensus362 96.08
PF12770287 CHAT: CHAT domain 92.27
PF14538154 Raptor_N: Raptor N-terminal CASPase like domain 91.18
>smart00115 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues Back     alignment and domain information 
Probab=100.00  E-value=1e-48  Score=341.43  Aligned_cols=212  Identities=36%  Similarity=0.557  Sum_probs=167.8

Q ss_pred             ccCCCCCceEEEEEeCCCCCCCCCCCCCCcHHHHHHHHHHHHhCCcEEEEEeCCCHHHHHHHHHHHhh-hcCCCCceEEE
Q psy13938         17 YNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQ-EDHSDADCLVI   95 (245)
Q Consensus        17 Y~m~~~~~G~aLIInn~~F~~~~~~~R~Gs~~D~~~l~~~f~~LgF~V~~~~nlt~~em~~~l~~~~~-~~~~~~d~~vv   95 (245)
                      |+|+++|+|+||||||..|.  .+.+|.|+++|+++|+++|++|||+|+++.|+|.+||.+.|++|++ .+|..+||++|
T Consensus         1 Y~m~~~p~g~alII~n~~f~--~~~~r~g~~~D~~~l~~~f~~lgF~V~~~~dlt~~em~~~l~~~~~~~~~~~~d~~v~   78 (241)
T smart00115        1 YRMNSKPRGLALIINNENFH--SLPRRNGTDVDAENLTELFQSLGYEVHVKNNLTAEEMLEELKEFAERPEHSDSDSFVC   78 (241)
T ss_pred             CCCCCCCCcEEEEEECccCC--CCcCCCCcHHHHHHHHHHHHHCCCEEEEecCCCHHHHHHHHHHHHhccccCCCCEEEE
Confidence            99999999999999999998  6899999999999999999999999999999999999999999998 48999999999


Q ss_pred             EeccCCcc------------hhhhhhccccccccccCCCceEEEEecccCcccCCCeeeecCC-Cc--ccccCCCCcCCC
Q psy13938         96 TVLTHGLG------------EQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSRA-NT--ETDAGVNAYKIP  160 (245)
Q Consensus        96 ~ilSHG~~------------i~~I~~~f~~~~c~~L~~KPKlf~iQACRG~~~~~gv~~~d~~-~~--e~~~~~~~~~ip  160 (245)
                      ||||||.+            +++|++.|++.+||+|+|||||||||||||++.+.|+...+.. ..  +.+ ......+|
T Consensus        79 ~~~sHG~~~~l~~~D~~~v~l~~i~~~f~~~~c~~L~~kPKlffiqACRg~~~~~g~~~~~~~~~~~~~~~-~~~~~~~p  157 (241)
T smart00115       79 VLLSHGEEGGIYGTDHSPLPLDEIFSLFNGDNCPSLAGKPKLFFIQACRGDELDGGVPVEDDVDDPPTEFE-DDAIYKIP  157 (241)
T ss_pred             EEcCCCCCCeEEEecCCEEEHHHHHHhccccCChhhcCCCcEEEEeCCCCCCCCCCeeccccccccccccc-ccccccCC
Confidence            99999987            8999999999999999999999999999999999888653221 11  111 22355799


Q ss_pred             CCCCeEEEecccCCchhhccCccccCcEEEee---ccCc---cccCCCc----cccCCCc---cceeeeeccccCccccc
Q psy13938        161 SYADFLIAYSTVEDSLLACRGTKLDGGVRLVS---RANT---ETDAGVN----AYKIPSY---ADFLIAYSTVEDCKLCL  227 (245)
Q Consensus       161 ~~~D~li~ysT~pg~~~~~~g~~~d~gv~l~~---~~~~---e~d~~~~----~~~iP~~---aDfL~~~sTve~~tl~~  227 (245)
                      ..+|+|++|||.||+++|+...  .++|.+.+   ....   ..+....    ...+-..   ..---|+|.+..+||+|
T Consensus       158 ~~~D~li~ysT~pG~va~r~~~--~gS~fi~~L~~~l~~~~~~~~l~~ilt~V~~~V~~~~~~~~~~kQ~p~~~st~L~k  235 (241)
T smart00115      158 VEADFLAAYSTTPGYVSWRNPT--RGSWFIQSLCQVLKEYARSLDLLDILTEVNRKVAVKFESVHAKKQMPTIESMTLTK  235 (241)
T ss_pred             CcCcEEEEEeCCCCeEeecCCC--CCchHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhhhhcccCCcEeCCccEeecCcc
Confidence            9999999999999999996543  35564311   1111   0010000    0011110   12246888777777999


Q ss_pred             ccccCC
Q psy13938        228 YPFIFP  233 (245)
Q Consensus       228 ~~~~~p  233 (245)
                      +|||+|
T Consensus       236 ~~yf~p  241 (241)
T smart00115      236 KLYFFP  241 (241)
T ss_pred             eeeCCC
Confidence            999998

Cysteine aspartases that mediate programmed cell death (apoptosis). Caspases are synthesised as zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologues.
>cd00032 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis) Back     alignment and domain information
>KOG3573|consensus Back     alignment and domain information
>PF00656 Peptidase_C14: Caspase domain; InterPro: IPR011600 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3573|consensus Back     alignment and domain information
>smart00115 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues Back     alignment and domain information
>cd00032 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis) Back     alignment and domain information
>COG4249 Uncharacterized protein containing caspase domain [General function prediction only] Back     alignment and domain information
>KOG1546|consensus Back     alignment and domain information
>PF12770 CHAT: CHAT domain Back     alignment and domain information
>PF14538 Raptor_N: Raptor N-terminal CASPase like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
1m72_A272 Crystal Structure Of Caspase-1 From Spodoptera Frug 2e-42
2nn3_C310 Structure Of Pro-Sf-Caspase-1 Length = 310 3e-41
3sir_A259 Crystal Structure Of Drice Length = 259 2e-39
3sip_A157 Crystal Structure Of Drice And Diap1-Bir1 Complex L 2e-32
4fdl_A305 Crystal Structure Of Caspase-7 Length = 305 3e-27
4fea_A247 Crystal Structure Of Caspase-7 In Complex With Allo 3e-27
1i4o_A280 Crystal Structure Of The XiapCASPASE-7 Complex Leng 3e-27
3r5k_A312 A Designed Redox-Controlled Caspase-7 Length = 312 2e-26
1k86_A253 Crystal Structure Of Caspase-7 Length = 253 3e-26
1shj_A262 Caspase-7 In Complex With Dica Allosteric Inhibitor 3e-26
1kmc_A303 Crystal Structure Of The Caspase-7 XIAP-Bir2 Comple 4e-26
3nkf_A277 Crystal Structure Of Human Ligand-Free Mature Caspa 4e-26
3s8e_A277 Phosphorylation Regulates Assembly Of The Caspase-6 4e-26
3v6m_A279 Inhibition Of Caspase-6 Activity By Single Mutation 4e-26
3v6l_A282 Crystal Structure Of Caspase-6 Inactivation Mutatio 4e-26
3k7e_A278 Crystal Structure Of Human Ligand-Free Mature Caspa 4e-26
1f1j_A305 Crystal Structure Of Caspase-7 In Complex With Acet 5e-26
3pd0_A250 Caspase-3 E246a Length = 250 5e-26
4fxo_A299 Zinc-Mediated Allosteric Inhibiton Of Caspase-6 Len 5e-26
2wdp_A293 Crystal Structure Of Ligand Free Human Caspase-6 Le 5e-26
1gqf_B265 Crystal Structure Of Human Procaspase-7 Length = 26 5e-26
4ehh_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 6e-26
4eha_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 6e-26
4ehl_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 7e-26
3itn_A250 Crystal Structure Of Pseudo-Activated Procaspase-3 8e-26
3h0e_A255 3,4-Dihydropyrimido(1,2-A)indol-10(2h)-Ones As Pote 8e-26
1cp3_A277 Crystal Structure Of The Complex Of Apopain With Th 8e-26
3pcx_A250 Caspase-3 E246a, K242a Double Mutant Length = 250 9e-26
2j30_A250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 9e-26
3pd1_A250 Caspase-3 K242a Length = 250 9e-26
2j33_A250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 9e-26
1qx3_A257 Conformational Restrictions In The Active Site Of U 1e-25
1nmq_A249 Extendend Tethering: In Situ Assembly Of Inhibitors 1e-25
2j31_A250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 1e-25
3h1p_A260 Mature Caspase-7 I213a With Devd-Cho Inhibitor Boun 3e-25
1shl_A245 Caspase-7 In Complex With Fica Allosteric Inhibitor 3e-25
3nr2_A294 Crystal Structure Of Caspase-6 Zymogen Length = 294 4e-25
1k88_A253 Crystal Structure Of Procaspase-7 Length = 253 4e-25
2j32_A250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 5e-25
4ehd_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 6e-25
4ejf_A279 Allosteric Peptides That Bind To A Caspase Zymogen 6e-25
4ehk_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 7e-25
4ehf_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 7e-25
4ehn_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 7e-25
3deh_A249 Crystal Structures Of Caspase-3 With Bound Isoquino 2e-24
3p4u_A157 Crystal Structure Of Active Caspase-6 In Complex Wi 2e-22
3qnw_A156 Caspase-6 In Complex With Z-Vad-Fmk Inhibitor Lengt 2e-22
3p45_A179 Crystal Structure Of Apo-Caspase-6 At Physiological 2e-22
2ql5_A173 Crystal Structure Of Caspase-7 With Inhibitor Ac-Dm 4e-21
1pau_A147 Crystal Structure Of The Complex Of Apopain With Th 2e-20
1nme_A146 Structure Of Casp-3 With Tethered Salicylate Length 2e-20
1i51_A148 Crystal Structure Of Caspase-7 Complexed With Xiap 3e-20
4dcp_A147 Crystal Structure Of Caspase 3, L168f Mutant Length 5e-20
4dco_A147 Crystal Structure Of Caspase 3, L168y Mutant Length 7e-20
4dcj_A147 Crystal Structure Of Caspase 3, L168d Mutant Length 1e-19
1i3o_A175 Crystal Structure Of The Complex Of Xiap-Bir2 And C 2e-19
2xzd_A149 Caspase-3 In Complex With An Inhibitory Darpin-3.4 3e-19
1i4e_B258 Crystal Structure Of The Caspase-8P35 COMPLEX Lengt 4e-17
3h11_B271 Zymogen Caspase-8:c-Flipl Protease Domain Complex L 6e-17
2k7z_A266 Solution Structure Of The Catalytic Domain Of Proca 6e-16
1qdu_A153 Crystal Structure Of The Complex Of Caspase-8 With 4e-15
2c2z_A159 Crystal Structure Of Caspase-8 In Complex With Aza- 4e-15
1qtn_A164 Crystal Structure Of The Complex Of Caspase-8 With 4e-15
1jxq_A284 Structure Of Cleaved, Card Domain Deleted Caspase-9 1e-14
1nw9_B277 Structure Of Caspase-9 In An Inhibitory Complex Wit 1e-14
2ar9_A278 Crystal Structure Of A Dimeric Caspase-9 Length = 2 2e-13
3rjm_A169 Caspase2 In Complex With Chdi Ligand 33c Length = 1 9e-12
2p2c_A169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 9e-12
3r5j_A160 Crystal Structure Of Active Caspase-2 Bound With Ac 9e-12
1pyo_A167 Crystal Structure Of Human Caspase-2 In Complex Wit 1e-11
3h11_A272 Zymogen Caspase-8:c-Flipl Protease Domain Complex L 5e-06
3d6h_A179 Crystal Structure Of Human Caspase-1 With A Natural 7e-06
3d6f_A179 Crystal Structure Of Human Caspase-1 With A Natural 8e-06
3d6m_A179 Crystal Structure Of Human Caspase-1 With A Natural 1e-05
1ice_A167 Structure And Mechanism Of Interleukin-1beta Conver 1e-05
1rwk_A178 Crystal Structure Of Human Caspase-1 In Complex Wit 1e-05
3ns7_A162 Succinic Acid Amides As P2-P3 Replacements For Inhi 1e-05
1ibc_A194 Crystal Structure Of Inhibited Interleukin-1beta Co 1e-05
2h4y_A178 Crystal Structure Of Human Caspase-1 (Arg286->lys) 3e-05
2hbr_A178 Crystal Structure Of Human Caspase-1 (Arg286->ala) 7e-05
1sc1_A178 Crystal Structure Of An Active-Site Ligand-Free For 1e-04
3e4c_A302 Procaspase-1 Zymogen Domain Crystal Strucutre Lengt 2e-04
2fp3_A316 Crystal Structure Of The Drosophila Initiator Caspa 4e-04
>pdb|1M72|A Chain A, Crystal Structure Of Caspase-1 From Spodoptera Frugiperda Length = 272 Back     alignment and structure 
Iteration: 1

 Score =  169 bits (427), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (64%), Gaps = 15/177 (8%)
Query: 8   MPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVY 67
           MPV +++  YNM+H  RG A++FNH+ F + ++  R G+  D  NL      LGF+V+V+
Sbjct: 16  MPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVF 75
Query: 68  TNPEFREITEILSNLSQEDHSDADCLVITVLTHG-LG----------EQKLWLPFTADKC 116
            N +  EI + +   ++ DHSDADCL++ VLTHG LG             LW  FTADKC
Sbjct: 76  PNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKC 135
Query: 117 RTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAG-VNAYKIPSYADFLIAYSTV 172
            TLAGKPK+FFIQAC+G +LDGG+ L   + TETD     +Y+IP +ADFLIA+STV
Sbjct: 136 PTLAGKPKLFFIQACQGDRLDGGITL---SRTETDGSPSTSYRIPVHADFLIAFSTV 189
>pdb|2NN3|C Chain C, Structure Of Pro-Sf-Caspase-1 Length = 310 Back     alignment and structure
>pdb|3SIR|A Chain A, Crystal Structure Of Drice Length = 259 Back     alignment and structure
>pdb|3SIP|A Chain A, Crystal Structure Of Drice And Diap1-Bir1 Complex Length = 157 Back     alignment and structure
>pdb|4FDL|A Chain A, Crystal Structure Of Caspase-7 Length = 305 Back     alignment and structure
>pdb|4FEA|A Chain A, Crystal Structure Of Caspase-7 In Complex With Allosteric Inhibitor Length = 247 Back     alignment and structure
>pdb|1I4O|A Chain A, Crystal Structure Of The XiapCASPASE-7 Complex Length = 280 Back     alignment and structure
>pdb|3R5K|A Chain A, A Designed Redox-Controlled Caspase-7 Length = 312 Back     alignment and structure
>pdb|1K86|A Chain A, Crystal Structure Of Caspase-7 Length = 253 Back     alignment and structure
>pdb|1SHJ|A Chain A, Caspase-7 In Complex With Dica Allosteric Inhibitor Length = 262 Back     alignment and structure
>pdb|1KMC|A Chain A, Crystal Structure Of The Caspase-7 XIAP-Bir2 Complex Length = 303 Back     alignment and structure
>pdb|3NKF|A Chain A, Crystal Structure Of Human Ligand-Free Mature Caspase-6 With Intersubunit Linker Attached Length = 277 Back     alignment and structure
>pdb|3S8E|A Chain A, Phosphorylation Regulates Assembly Of The Caspase-6 Substrate-Binding Groove Length = 277 Back     alignment and structure
>pdb|3V6M|A Chain A, Inhibition Of Caspase-6 Activity By Single Mutation Outside The Active Site Length = 279 Back     alignment and structure
>pdb|3V6L|A Chain A, Crystal Structure Of Caspase-6 Inactivation Mutation Length = 282 Back     alignment and structure
>pdb|3K7E|A Chain A, Crystal Structure Of Human Ligand-Free Mature Caspase-6 Length = 278 Back     alignment and structure
>pdb|1F1J|A Chain A, Crystal Structure Of Caspase-7 In Complex With Acetyl-asp-glu-val-asp- Cho Length = 305 Back     alignment and structure
>pdb|3PD0|A Chain A, Caspase-3 E246a Length = 250 Back     alignment and structure
>pdb|4FXO|A Chain A, Zinc-Mediated Allosteric Inhibiton Of Caspase-6 Length = 299 Back     alignment and structure
>pdb|2WDP|A Chain A, Crystal Structure Of Ligand Free Human Caspase-6 Length = 293 Back     alignment and structure
>pdb|4EHH|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|4EHA|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|4EHL|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|3ITN|A Chain A, Crystal Structure Of Pseudo-Activated Procaspase-3 Length = 250 Back     alignment and structure
>pdb|3H0E|A Chain A, 3,4-Dihydropyrimido(1,2-A)indol-10(2h)-Ones As Potent Non- Peptidic Inhibitors Of Caspase-3 Length = 255 Back     alignment and structure
>pdb|1CP3|A Chain A, Crystal Structure Of The Complex Of Apopain With The Tetrapeptide Inhibitor Ace-Dvad-Fmc Length = 277 Back     alignment and structure
>pdb|3PCX|A Chain A, Caspase-3 E246a, K242a Double Mutant Length = 250 Back     alignment and structure
>pdb|2J30|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of (Pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|3PD1|A Chain A, Caspase-3 K242a Length = 250 Back     alignment and structure
>pdb|2J33|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of (Pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|1QX3|A Chain A, Conformational Restrictions In The Active Site Of Unliganded Human Caspase-3 Length = 257 Back     alignment and structure
>pdb|1NMQ|A Chain A, Extendend Tethering: In Situ Assembly Of Inhibitors Length = 249 Back     alignment and structure
>pdb|2J31|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of(pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|3H1P|A Chain A, Mature Caspase-7 I213a With Devd-Cho Inhibitor Bound To Active Site Length = 260 Back     alignment and structure
>pdb|1SHL|A Chain A, Caspase-7 In Complex With Fica Allosteric Inhibitor Length = 245 Back     alignment and structure
>pdb|3NR2|A Chain A, Crystal Structure Of Caspase-6 Zymogen Length = 294 Back     alignment and structure
>pdb|1K88|A Chain A, Crystal Structure Of Procaspase-7 Length = 253 Back     alignment and structure
>pdb|2J32|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of(Pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|4EHD|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|4EJF|A Chain A, Allosteric Peptides That Bind To A Caspase Zymogen And Mediate Caspase Tetramerization Length = 279 Back     alignment and structure
>pdb|4EHK|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|4EHF|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|4EHN|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|3DEH|A Chain A, Crystal Structures Of Caspase-3 With Bound Isoquinoline-1,3, 4-Trione Derivative Inhibitors Length = 249 Back     alignment and structure
>pdb|3P4U|A Chain A, Crystal Structure Of Active Caspase-6 In Complex With Ac-Veid-Cho Inhibitor Length = 157 Back     alignment and structure
>pdb|3QNW|A Chain A, Caspase-6 In Complex With Z-Vad-Fmk Inhibitor Length = 156 Back     alignment and structure
>pdb|3P45|A Chain A, Crystal Structure Of Apo-Caspase-6 At Physiological Ph Length = 179 Back     alignment and structure
>pdb|2QL5|A Chain A, Crystal Structure Of Caspase-7 With Inhibitor Ac-Dmqd-Cho Length = 173 Back     alignment and structure
>pdb|1PAU|A Chain A, Crystal Structure Of The Complex Of Apopain With The Tetrapeptide Aldehyde Inhibitor Ac-Devd-Cho Length = 147 Back     alignment and structure
>pdb|1NME|A Chain A, Structure Of Casp-3 With Tethered Salicylate Length = 146 Back     alignment and structure
>pdb|1I51|A Chain A, Crystal Structure Of Caspase-7 Complexed With Xiap Length = 148 Back     alignment and structure
>pdb|4DCP|A Chain A, Crystal Structure Of Caspase 3, L168f Mutant Length = 147 Back     alignment and structure
>pdb|4DCO|A Chain A, Crystal Structure Of Caspase 3, L168y Mutant Length = 147 Back     alignment and structure
>pdb|4DCJ|A Chain A, Crystal Structure Of Caspase 3, L168d Mutant Length = 147 Back     alignment and structure
>pdb|1I3O|A Chain A, Crystal Structure Of The Complex Of Xiap-Bir2 And Caspase 3 Length = 175 Back     alignment and structure
>pdb|2XZD|A Chain A, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 149 Back     alignment and structure
>pdb|1I4E|B Chain B, Crystal Structure Of The Caspase-8P35 COMPLEX Length = 258 Back     alignment and structure
>pdb|3H11|B Chain B, Zymogen Caspase-8:c-Flipl Protease Domain Complex Length = 271 Back     alignment and structure
>pdb|2K7Z|A Chain A, Solution Structure Of The Catalytic Domain Of Procaspase-8 Length = 266 Back     alignment and structure
>pdb|1QDU|A Chain A, Crystal Structure Of The Complex Of Caspase-8 With The Tripeptide Ketone Inhibitor Zevd-Dcbmk Length = 153 Back     alignment and structure
>pdb|2C2Z|A Chain A, Crystal Structure Of Caspase-8 In Complex With Aza-Peptide Michael Acceptor Inhibitor Length = 159 Back     alignment and structure
>pdb|1QTN|A Chain A, Crystal Structure Of The Complex Of Caspase-8 With The Tetrapeptide Inhibitor Ace-Ietd-Aldehyde Length = 164 Back     alignment and structure
>pdb|1JXQ|A Chain A, Structure Of Cleaved, Card Domain Deleted Caspase-9 Length = 284 Back     alignment and structure
>pdb|1NW9|B Chain B, Structure Of Caspase-9 In An Inhibitory Complex With Xiap- Bir3 Length = 277 Back     alignment and structure
>pdb|2AR9|A Chain A, Crystal Structure Of A Dimeric Caspase-9 Length = 278 Back     alignment and structure
>pdb|3RJM|A Chain A, Caspase2 In Complex With Chdi Ligand 33c Length = 169 Back     alignment and structure
>pdb|2P2C|A Chain A, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3R5J|A Chain A, Crystal Structure Of Active Caspase-2 Bound With Ac-Advad-Cho Length = 160 Back     alignment and structure
>pdb|1PYO|A Chain A, Crystal Structure Of Human Caspase-2 In Complex With Acetyl-Leu-Asp- Glu-Ser-Asp-Cho Length = 167 Back     alignment and structure
>pdb|3H11|A Chain A, Zymogen Caspase-8:c-Flipl Protease Domain Complex Length = 272 Back     alignment and structure
>pdb|3D6H|A Chain A, Crystal Structure Of Human Caspase-1 With A Naturally-Occurring Asn263->ser Substitution In Complex With 3-[2-(2- Benzyloxycarbonylamino-3-Methyl-Butyrylamino)- Propionylamino]-4-Oxo- Pentanoic Acid (Z-Vad-Fmk) Length = 179 Back     alignment and structure
>pdb|3D6F|A Chain A, Crystal Structure Of Human Caspase-1 With A Naturally-Occurring Arg240->gln Substitution In Complex With 3-[2-(2- Benzyloxycarbonylamino-3-Methyl-Butyrylamino)- Propionylamino]-4-Oxo- Pentanoic Acid (Z-Vad-Fmk) Length = 179 Back     alignment and structure
>pdb|3D6M|A Chain A, Crystal Structure Of Human Caspase-1 With A Naturally-Occurring Lys319->arg Substitution In Complex With 3-[2-(2- Benzyloxycarbonylamino-3-Methyl-Butyrylamino)- Propionylamino]-4-Oxo- Pentanoic Acid (Z-Vad-Fmk) Length = 179 Back     alignment and structure
>pdb|1ICE|A Chain A, Structure And Mechanism Of Interleukin-1beta Converting Enzyme Length = 167 Back     alignment and structure
>pdb|1RWK|A Chain A, Crystal Structure Of Human Caspase-1 In Complex With 3-(2-Mercapto- Acetylamino)-4-Oxo-Pentanoic Acid Length = 178 Back     alignment and structure
>pdb|3NS7|A Chain A, Succinic Acid Amides As P2-P3 Replacements For Inhibitors Of Interleukin-1beta Converting Enzyme (Ice Or Caspase 1) Length = 162 Back     alignment and structure
>pdb|1IBC|A Chain A, Crystal Structure Of Inhibited Interleukin-1beta Converting Enzyme Length = 194 Back     alignment and structure
>pdb|2H4Y|A Chain A, Crystal Structure Of Human Caspase-1 (Arg286->lys) In Complex With 3- [2-(2-Benzyloxycarbonylamino-3-Methyl-Butyrylamino)- Propionylamino]- 4-Oxo-Pentanoic Acid (Z-Vad-Fmk) Length = 178 Back     alignment and structure
>pdb|2HBR|A Chain A, Crystal Structure Of Human Caspase-1 (Arg286->ala) In Complex With 3- [2-(2-Benzyloxycarbonylamino-3-Methyl-Butyrylamino)- Propionylamino]- 4-Oxo-Pentanoic Acid (Z-Vad-Fmk) Length = 178 Back     alignment and structure
>pdb|1SC1|A Chain A, Crystal Structure Of An Active-Site Ligand-Free Form Of The Human Caspase-1 C285a Mutant Length = 178 Back     alignment and structure
>pdb|3E4C|A Chain A, Procaspase-1 Zymogen Domain Crystal Strucutre Length = 302 Back     alignment and structure
>pdb|2FP3|A Chain A, Crystal Structure Of The Drosophila Initiator Caspase Dronc Length = 316 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
2nn3_C310 Caspase-1; cysteine protease, hydrolase; 3.00A {Sp 3e-48
3sir_A259 Caspase; hydrolase; 2.68A {Drosophila melanogaster 3e-48
1m72_A272 Caspase-1; caspase, cysteine protease, hydrolase-h 8e-47
2dko_A146 Caspase-3; low barrier hydrogen bond, caspase, dru 6e-45
2ql9_A173 Caspase-7; cysteine protease, apoptosis, thiol pro 2e-44
3od5_A278 Caspase-6; caspase domain, apoptotic protease, hyd 2e-44
2j32_A250 Caspase-3; Pro-caspase3, thiol protease, hydrolase 2e-44
1f1j_A305 Caspase-7 protease; caspase-7, cysteine protease, 4e-44
4ehd_A277 Caspase-3; caspase, apoptosis, allosteric inhibiti 8e-44
1qtn_A164 Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst 7e-43
1nw9_B277 Caspase 9, apoptosis-related cysteine protease; XI 2e-41
1pyo_A167 Caspase-2; apoptosis, caspase, alpha-beta, thiol p 2e-40
3p45_A179 Caspase-6; protease, huntington'S disease, physio 2e-40
3h11_A272 CAsp8 and FADD-like apoptosis regulator; cell deat 4e-39
3h11_B271 Caspase-8; cell death, apoptosis, caspase, alterna 7e-39
3e4c_A302 Caspase-1; zymogen, inflammasome, ICE, IL-1B, inna 2e-38
2fp3_A316 Caspase NC; apoptosis, initiator caspase activatio 5e-38
2h54_A178 Caspase-1; allosteric site, dimer interface, hydro 4e-36
3uoa_B 390 Mucosa-associated lymphoid tissue lymphoma transl 3e-05
2xzd_B118 Caspase-3; hydrolase-protein binding complex, de n 3e-05
2xzd_B118 Caspase-3; hydrolase-protein binding complex, de n 5e-05
2dko_B103 Caspase-3; low barrier hydrogen bond, caspase, dru 4e-05
2dko_B103 Caspase-3; low barrier hydrogen bond, caspase, dru 6e-05
2ql9_B97 Caspase-7; cysteine protease, apoptosis, thiol pro 4e-04
2ql9_B97 Caspase-7; cysteine protease, apoptosis, thiol pro 5e-04
1qtn_B95 Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst 5e-04
1qtn_B95 Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst 6e-04
1pyo_B105 Caspase-2; apoptosis, caspase, alpha-beta, thiol p 6e-04
3rjm_B117 Caspase-2; caspase-2, caspase, hydrolase-hydrolase 8e-04
>2nn3_C Caspase-1; cysteine protease, hydrolase; 3.00A {Spodoptera frugiperda} Length = 310 Back     alignment and structure
 Score =  160 bits (405), Expect = 3e-48
 Identities = 84/188 (44%), Positives = 114/188 (60%), Gaps = 16/188 (8%)

Query: 8   MPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVY 67
           MPV +++  YNM+H  RG A++FNH+ F + ++  R G+  D  NL      LGF+V+V+
Sbjct: 44  MPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVF 103

Query: 68  TNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQ-----------KLWLPFTADKC 116
            N +  EI + +   ++ DHSDADCL++ VLT G                LW  FTADKC
Sbjct: 104 PNLKSEEINKFIQQTAEMDHSDADCLLVAVLTAGELGMLYAKDTHYKPDNLWYYFTADKC 163

Query: 117 RTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAGVNA-YKIPSYADFLIAYSTVEDS 175
            TLAGKPK+FFIQAC+G +LDGG+ L     TETD   +  Y+IP +ADFLIA+STV   
Sbjct: 164 PTLAGKPKLFFIQACQGDRLDGGITLSR---TETDGSPSTSYRIPVHADFLIAFSTVPGY 220

Query: 176 LLACRGTK 183
             + R T 
Sbjct: 221 -FSWRNTT 227
>3sir_A Caspase; hydrolase; 2.68A {Drosophila melanogaster} PDB: 3sip_A Length = 259 Back     alignment and structure
>1m72_A Caspase-1; caspase, cysteine protease, hydrolase-hydrolase inhibitor CO; 2.30A {Spodoptera frugiperda} SCOP: c.17.1.1 PDB: 3sip_B Length = 272 Back     alignment and structure
>2dko_A Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 1nme_A 2h5i_A 2h5j_A 2h65_A 2xyg_A* 2xyh_A 2xyp_A* 2xzd_A 2xzt_A 2y0b_A 3edq_A 1gfw_A 1re1_A* 1pau_A* 1rhk_A* 1rhm_A* 1rhq_A* 1rhr_A* 1rhu_A* 1rhj_A* ... Length = 146 Back     alignment and structure
>2ql9_A Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_A* 2ql5_A* 2qlb_A* 2qlf_A 2qlj_A* 3edr_A 3ibc_A 3ibf_A 1i51_A Length = 173 Back     alignment and structure
>3od5_A Caspase-6; caspase domain, apoptotic protease, hydrolase-hydrolase INHI complex; 1.60A {Homo sapiens} PDB: 3k7e_A 3s70_A 3v6m_A 3v6l_A 3nr2_A 2wdp_A 3nkf_A 3s8e_A 3qnw_A* 3p4u_A* 3p45_B 3qnw_B* 3p4u_B* Length = 278 Back     alignment and structure
>2j32_A Caspase-3; Pro-caspase3, thiol protease, hydrolase, hydrolase-hydrolase inhibitor complex; 1.30A {Homo sapiens} PDB: 2j30_A 3h0e_A* 2j33_A 3pd1_A 2j31_A 3pcx_A 1nms_A* 1nmq_A* 3deh_A* 3dei_A* 3dej_A* 3dek_A* 3pd0_A 3itn_A 1qx3_A Length = 250 Back     alignment and structure
>1f1j_A Caspase-7 protease; caspase-7, cysteine protease, hydrolase, apoptosis, hydrolas hydrolase inhibitor complex; 2.35A {Homo sapiens} SCOP: c.17.1.1 PDB: 1kmc_A 3r5k_A 1i4o_A 1gqf_A 3h1p_A 1shj_A* 1k86_A 1k88_A 1shl_A* Length = 305 Back     alignment and structure
>4ehd_A Caspase-3; caspase, apoptosis, allosteric inhibition; 1.58A {Homo sapiens} PDB: 4ehk_A 4ehf_A 4ehn_A 1cp3_A 4ehh_A 4eha_A 4ehl_A 1i3o_A Length = 277 Back     alignment and structure
>1qtn_A Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_A* 3kjq_A* 2y1l_A 2c2z_A 1qdu_A* 1f9e_A* Length = 164 Back     alignment and structure
>1nw9_B Caspase 9, apoptosis-related cysteine protease; XIAP, caspase inhibition, caspase activation, dimerization; 2.40A {Homo sapiens} SCOP: c.17.1.1 PDB: 1jxq_A* 2ar9_A Length = 277 Back     alignment and structure
>1pyo_A Caspase-2; apoptosis, caspase, alpha-beta, thiol protease, hydrolase-HY inhibitor complex; 1.65A {Homo sapiens} SCOP: c.17.1.1 PDB: 3rjm_A* 2p2c_A 3r5j_A 3r6g_A 3r6l_A 3r7b_A 3r7n_A 3r7s_A Length = 167 Back     alignment and structure
>3p45_A Caspase-6; protease, huntington'S disease, physio PH, competitive inhibition, hydrolase; 2.53A {Homo sapiens} Length = 179 Back     alignment and structure
>3h11_A CAsp8 and FADD-like apoptosis regulator; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 3h13_A Length = 272 Back     alignment and structure
>3h11_B Caspase-8; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 2k7z_A 1i4e_B 2fun_B 2c2z_B* Length = 271 Back     alignment and structure
>3e4c_A Caspase-1; zymogen, inflammasome, ICE, IL-1B, innate immunity, apoptosis, hydrolase, protease protease; 2.05A {Homo sapiens} Length = 302 Back     alignment and structure
>2fp3_A Caspase NC; apoptosis, initiator caspase activation, dimerization, active site conformation, hydrolysis/apoptosis complex; 2.50A {Drosophila melanogaster} Length = 316 Back     alignment and structure
>2h54_A Caspase-1; allosteric site, dimer interface, hydrolase; HET: PHQ; 1.80A {Homo sapiens} PDB: 1rwm_A* 1rwk_A* 1rwo_A* 1rwp_A* 1rwv_A* 1rww_A* 1rwn_A* 2h48_A* 2h4w_A* 1rwx_A* 2hbq_A* 2hby_A* 1ibc_A 3d6m_A* 2h4y_A* 2h51_A* 3d6f_A* 3d6h_A* 2hbz_A* 2hbr_A* ... Length = 178 Back     alignment and structure
>3uoa_B Mucosa-associated lymphoid tissue lymphoma transl protein 1; paracaspase, lymphoma, NF-KB signalling, caspase fold, immun fold, hydrolase-hydrolase inhibitor complex; 1.75A {Homo sapiens} PDB: 3uo8_B 3v55_A 3v4l_A* 3v4o_A* Length = 390 Back     alignment and structure
>2xzd_B Caspase-3; hydrolase-protein binding complex, de novo protein, apoptosi ankyrin repeat protein, ribosome display; 2.10A {Homo sapiens} PDB: 2xzt_B 2y0b_B Length = 118 Back     alignment and structure
>2xzd_B Caspase-3; hydrolase-protein binding complex, de novo protein, apoptosi ankyrin repeat protein, ribosome display; 2.10A {Homo sapiens} PDB: 2xzt_B 2y0b_B Length = 118 Back     alignment and structure
>2dko_B Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 2c2k_B* 2c2m_B* 2c2o_B* 2c1e_B* 2cdr_B* 2cnk_B* 2cnl_B* 2cnn_B* 2cno_B* 2cjy_B 1pau_B 1re1_B* 1rhk_B* 1rhm_B* 1rhq_B* 1rhr_B* 1rhu_B* 1rhj_B* 1i3o_B* 3edq_B ... Length = 103 Back     alignment and structure
>2dko_B Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 2c2k_B* 2c2m_B* 2c2o_B* 2c1e_B* 2cdr_B* 2cnk_B* 2cnl_B* 2cnn_B* 2cno_B* 2cjy_B 1pau_B 1re1_B* 1rhk_B* 1rhm_B* 1rhq_B* 1rhr_B* 1rhu_B* 1rhj_B* 1i3o_B* 3edq_B ... Length = 103 Back     alignment and structure
>2ql9_B Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_B* 2ql5_B* 2qlb_B* 2qlf_B 2qlj_B* 3edr_B 3ibc_B 3ibf_B 1i51_B Length = 97 Back     alignment and structure
>2ql9_B Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_B* 2ql5_B* 2qlb_B* 2qlf_B 2qlj_B* 3edr_B 3ibc_B 3ibf_B 1i51_B Length = 97 Back     alignment and structure
>1qtn_B Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_B* 3kjq_B* 2y1l_B 1f9e_B* 1qdu_B* Length = 95 Back     alignment and structure
>1qtn_B Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_B* 3kjq_B* 2y1l_B 1f9e_B* 1qdu_B* Length = 95 Back     alignment and structure
>1pyo_B Caspase-2; apoptosis, caspase, alpha-beta, thiol protease, hydrolase-HY inhibitor complex; 1.65A {Homo sapiens} SCOP: c.17.1.1 PDB: 2p2c_B 3r5j_B 3r6g_B 3r7b_B 3r7n_B 3r7s_B 3r6l_B Length = 105 Back     alignment and structure
>3rjm_B Caspase-2; caspase-2, caspase, hydrolase-hydrolase inhibitor; HET: 3PX; 2.55A {Homo sapiens} Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
3od5_A278 Caspase-6; caspase domain, apoptotic protease, hyd 100.0
3sir_A259 Caspase; hydrolase; 2.68A {Drosophila melanogaster 100.0
3h11_B271 Caspase-8; cell death, apoptosis, caspase, alterna 100.0
4ehd_A277 Caspase-3; caspase, apoptosis, allosteric inhibiti 100.0
1m72_A272 Caspase-1; caspase, cysteine protease, hydrolase-h 100.0
2nn3_C310 Caspase-1; cysteine protease, hydrolase; 3.00A {Sp 100.0
1nw9_B277 Caspase 9, apoptosis-related cysteine protease; XI 100.0
3e4c_A302 Caspase-1; zymogen, inflammasome, ICE, IL-1B, inna 100.0
2fp3_A316 Caspase NC; apoptosis, initiator caspase activatio 100.0
2j32_A250 Caspase-3; Pro-caspase3, thiol protease, hydrolase 100.0
1f1j_A305 Caspase-7 protease; caspase-7, cysteine protease, 100.0
3h11_A272 CAsp8 and FADD-like apoptosis regulator; cell deat 100.0
3p45_A179 Caspase-6; protease, huntington'S disease, physio 100.0
2dko_A146 Caspase-3; low barrier hydrogen bond, caspase, dru 100.0
1qtn_A164 Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst 100.0
2ql9_A173 Caspase-7; cysteine protease, apoptosis, thiol pro 100.0
1pyo_A167 Caspase-2; apoptosis, caspase, alpha-beta, thiol p 100.0
2h54_A178 Caspase-1; allosteric site, dimer interface, hydro 100.0
3uoa_B 390 Mucosa-associated lymphoid tissue lymphoma transl 99.94
3bij_A285 Uncharacterized protein GSU0716; alpha-beta protei 99.14
1sc3_B88 Interleukin-1 beta convertase; malonate-bound casp 99.09
3rjm_B117 Caspase-2; caspase-2, caspase, hydrolase-hydrolase 98.95
3h11_B271 Caspase-8; cell death, apoptosis, caspase, alterna 98.83
1pyo_B105 Caspase-2; apoptosis, caspase, alpha-beta, thiol p 98.79
3sir_A259 Caspase; hydrolase; 2.68A {Drosophila melanogaster 98.76
1qtn_B95 Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst 98.74
1m72_A272 Caspase-1; caspase, cysteine protease, hydrolase-h 98.72
4f6o_A350 Metacaspase-1; rossmann fold, hydrolase; HET: DFH; 98.71
3od5_A278 Caspase-6; caspase domain, apoptotic protease, hyd 98.71
1nw9_B277 Caspase 9, apoptosis-related cysteine protease; XI 98.69
2xzd_B118 Caspase-3; hydrolase-protein binding complex, de n 98.69
4af8_A367 Metacaspase MCA2; hydrolase, cysteine peptidase, c 98.68
2fp3_A316 Caspase NC; apoptosis, initiator caspase activatio 98.68
4ehd_A277 Caspase-3; caspase, apoptosis, allosteric inhibiti 98.67
3h11_A272 CAsp8 and FADD-like apoptosis regulator; cell deat 98.63
2ql9_B97 Caspase-7; cysteine protease, apoptosis, thiol pro 98.61
2j32_A250 Caspase-3; Pro-caspase3, thiol protease, hydrolase 98.6
2nn3_C310 Caspase-1; cysteine protease, hydrolase; 3.00A {Sp 98.59
2dko_B103 Caspase-3; low barrier hydrogen bond, caspase, dru 98.58
1sc3_B88 Interleukin-1 beta convertase; malonate-bound casp 98.58
1f1j_A305 Caspase-7 protease; caspase-7, cysteine protease, 98.57
3e4c_A302 Caspase-1; zymogen, inflammasome, ICE, IL-1B, inna 98.52
1qtn_B95 Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst 98.48
1pyo_B105 Caspase-2; apoptosis, caspase, alpha-beta, thiol p 98.48
2ql9_B97 Caspase-7; cysteine protease, apoptosis, thiol pro 98.48
2dko_B103 Caspase-3; low barrier hydrogen bond, caspase, dru 98.47
3uoa_B 390 Mucosa-associated lymphoid tissue lymphoma transl 96.21
3rjm_B117 Caspase-2; caspase-2, caspase, hydrolase-hydrolase 94.92
2xzd_B118 Caspase-3; hydrolase-protein binding complex, de n 94.6
>3od5_A Caspase-6; caspase domain, apoptotic protease, hydrolase-hydrolase INHI complex; 1.60A {Homo sapiens} SCOP: c.17.1.0 PDB: 3k7e_A 3s70_A 3v6m_A 3v6l_A 3nr2_A 4fxo_A 2wdp_A 3nkf_A 3s8e_A 4ejf_A 3qnw_A* 3p4u_A* 3p45_B 3qnw_B* 3p4u_B* Back     alignment and structure
Probab=100.00  E-value=4.4e-54  Score=381.00  Aligned_cols=226  Identities=32%  Similarity=0.479  Sum_probs=174.1

Q ss_pred             CCCCCCCCCcccCCCCCceEEEEEeCCCCCCC-CCCCCCCcHHHHHHHHHHHHhCCcEEEEEeCCCHHHHHHHHHHHhhh
Q psy13938          7 PMPVAKDSAEYNMSHPRRGRALVFNHDEFQMD-NMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQE   85 (245)
Q Consensus         7 ~~~~~~~~~~Y~m~~~~~G~aLIInn~~F~~~-~~~~R~Gs~~D~~~l~~~f~~LgF~V~~~~nlt~~em~~~l~~~~~~   85 (245)
                      .+|+++.++.|+|+++++|+||||||.+|.+. .++.|.||++|+++|+++|++|||+|.+++|+|++||.+.|++|+++
T Consensus         4 ~~~~~~~~~~Y~m~~~~rg~aLIInn~~F~~~~~l~~R~Gt~~D~~~L~~~f~~LGF~V~~~~dlt~~em~~~l~~~~~~   83 (278)
T 3od5_A            4 KREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTV   83 (278)
T ss_dssp             ----CCTTCBCCCCSSBCCEEEEEECCCCCGGGCCCCCTTHHHHHHHHHHHHHHTTCEEEEEESCCHHHHHHHHHHHHHS
T ss_pred             ccCCCCcccccCCCCCCcCEEEEEeccccCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEecCCCHHHHHHHHHHHHhh
Confidence            57889999999999999999999999999864 68999999999999999999999999999999999999999999988


Q ss_pred             cCCCCceEEEEeccCCcc-----------hhhhhhccccccccccCCCceEEEEecccCcccCCCeeeecCCC-------
Q psy13938         86 DHSDADCLVITVLTHGLG-----------EQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSRAN-------  147 (245)
Q Consensus        86 ~~~~~d~~vv~ilSHG~~-----------i~~I~~~f~~~~c~~L~~KPKlf~iQACRG~~~~~gv~~~d~~~-------  147 (245)
                      +|..+||+||||||||.+           +++|+++|++.+||+|+|||||||||||||++.+.|+...+++.       
T Consensus        84 ~h~~~d~~vv~ilSHG~~g~i~g~D~~v~l~~I~~~f~~~~CpsL~gKPKlffiQACRG~~~~~g~~~~~~~~~~~~~l~  163 (278)
T 3od5_A           84 SHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLD  163 (278)
T ss_dssp             CCTTBSCEEEEEESCEETTEEECSSSEEEHHHHHHTTSTTTCGGGTTSCEEEEEESCCSSBCBCEECCC-----------
T ss_pred             cccCCCEEEEEEECCCCCCEEEEeCCeEEHHHHHHHhccccChhhcCCCcEEEEecCCCCcccCCeeccccccccccccc
Confidence            999999999999999987           89999999999999999999999999999999999887533210       


Q ss_pred             -ccccc-CCCCcCCCCCCCeEEEecccCCchhhccCccccCcEEEee--c-cCc---cccC---------CCc-cc--cC
Q psy13938        148 -TETDA-GVNAYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVRLVS--R-ANT---ETDA---------GVN-AY--KI  207 (245)
Q Consensus       148 -~e~~~-~~~~~~ip~~~D~li~ysT~pg~~~~~~g~~~d~gv~l~~--~-~~~---e~d~---------~~~-~~--~i  207 (245)
                       .+++. ..+...+|.++|||++|||+||++|||...+  ++|.+.+  . ...   ..+.         .+. ..  ..
T Consensus       164 ~~~~~~~~~~~~~iP~~aD~Li~yST~pG~vs~R~~~~--GS~fIq~L~~~l~~~~~~~dl~~ilt~Vn~~V~~~~~~~~  241 (278)
T 3od5_A          164 TNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVN--GSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFC  241 (278)
T ss_dssp             ----------CCCEETTTTEEEEESSCTTBCCEEETTT--EEHHHHHHHHHHHHHTTTSCHHHHHHHHHHHHHHCCCCCC
T ss_pred             ccccccccccccccCCCCCeEEEEeCCCCeEEecCCCC--CcHHHHHHHHHHHhhCCCCCHHHHHHHHHHHHHHHhhhcC
Confidence             11110 2235679999999999999999999986433  4554311  1 110   0000         000 00  01


Q ss_pred             CCc-cceeeeeccccCcccccccccCCCc
Q psy13938        208 PSY-ADFLIAYSTVEDCKLCLYPFIFPNP  235 (245)
Q Consensus       208 P~~-aDfL~~~sTve~~tl~~~~~~~pg~  235 (245)
                      |.. ..-.-|||.+. +||||+|||+|+.
T Consensus       242 ~~~~~~~~kQ~P~~~-stLtk~lyf~~~~  269 (278)
T 3od5_A          242 KDPSAIGKKQVPCFA-SMLTKKLHFFPKS  269 (278)
T ss_dssp             SSGGGTTCBCCCEEE-ECCCSBCCCCCC-
T ss_pred             CCccccCceEcceeE-EecceEEEeCCCC
Confidence            111 11446888775 8999999999985
>3sir_A Caspase; hydrolase; 2.68A {Drosophila melanogaster} PDB: 3sip_A Back     alignment and structure
>3h11_B Caspase-8; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} SCOP: c.17.1.1 PDB: 2k7z_A 1i4e_B 2fun_B 2c2z_B* Back     alignment and structure
>4ehd_A Caspase-3; caspase, apoptosis, allosteric inhibition; 1.58A {Homo sapiens} PDB: 4ehk_A 4ehf_A 4ehn_A 1cp3_A 4ehh_A 4eha_A 4ehl_A 1i3o_A Back     alignment and structure
>1m72_A Caspase-1; caspase, cysteine protease, hydrolase-hydrolase inhibitor CO; 2.30A {Spodoptera frugiperda} SCOP: c.17.1.1 PDB: 3sip_B Back     alignment and structure
>2nn3_C Caspase-1; cysteine protease, hydrolase; 3.00A {Spodoptera frugiperda} Back     alignment and structure
>1nw9_B Caspase 9, apoptosis-related cysteine protease; XIAP, caspase inhibition, caspase activation, dimerization; 2.40A {Homo sapiens} SCOP: c.17.1.1 PDB: 1jxq_A* 2ar9_A Back     alignment and structure
>3e4c_A Caspase-1; zymogen, inflammasome, ICE, IL-1B, innate immunity, apoptosis, hydrolase, protease protease; 2.05A {Homo sapiens} Back     alignment and structure
>2fp3_A Caspase NC; apoptosis, initiator caspase activation, dimerization, active site conformation, hydrolysis/apoptosis complex; 2.50A {Drosophila melanogaster} Back     alignment and structure
>2j32_A Caspase-3; Pro-caspase3, thiol protease, hydrolase, hydrolase-hydrolase inhibitor complex; 1.30A {Homo sapiens} PDB: 2j30_A 3h0e_A* 2j33_A 3pd1_A 2j31_A 3pcx_A 1nms_A* 1nmq_A* 3deh_A* 3dei_A* 3dej_A* 3dek_A* 3pd0_A 3itn_A 1qx3_A Back     alignment and structure
>1f1j_A Caspase-7 protease; caspase-7, cysteine protease, hydrolase, apoptosis, hydrolas hydrolase inhibitor complex; 2.35A {Homo sapiens} SCOP: c.17.1.1 PDB: 1kmc_A 3r5k_A 1i4o_A 1gqf_A 3h1p_A 1shj_A* 1k86_A 1k88_A 1shl_A* Back     alignment and structure
>3h11_A CAsp8 and FADD-like apoptosis regulator; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 3h13_A Back     alignment and structure
>3p45_A Caspase-6; protease, huntington'S disease, physio PH, competitive inhibition, hydrolase; 2.53A {Homo sapiens} Back     alignment and structure
>2dko_A Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 1nme_A 2h5i_A 2h5j_A 2h65_A 2xyg_A* 2xyh_A 2xyp_A* 2xzd_A 2xzt_A 2y0b_A 3edq_A 1gfw_A 1re1_A* 1pau_A* 1rhk_A* 1rhm_A* 1rhq_A* 1rhr_A* 1rhu_A* 1rhj_A* ... Back     alignment and structure
>1qtn_A Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_A* 3kjq_A* 2y1l_A 2c2z_A 1qdu_A* 1f9e_A* Back     alignment and structure
>2ql9_A Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_A* 2ql5_A* 2qlb_A* 2qlf_A 2qlj_A* 3edr_A 3ibc_A 3ibf_A 1i51_A Back     alignment and structure
>1pyo_A Caspase-2; apoptosis, caspase, alpha-beta, thiol protease, hydrolase-HY inhibitor complex; 1.65A {Homo sapiens} SCOP: c.17.1.1 PDB: 3rjm_A* 2p2c_A 3r5j_A 3r6g_A 3r6l_A 3r7b_A 3r7n_A 3r7s_A Back     alignment and structure
>2h54_A Caspase-1; allosteric site, dimer interface, hydrolase; HET: PHQ; 1.80A {Homo sapiens} PDB: 1rwm_A* 1rwk_A* 1rwo_A* 1rwp_A* 1rwv_A* 1rww_A* 1rwn_A* 2h48_A* 2h4w_A* 1rwx_A* 2hbq_A* 2hby_A* 1ibc_A 3d6m_A* 2h4y_A* 2h51_A* 3d6f_A* 3d6h_A* 2hbz_A* 2hbr_A* ... Back     alignment and structure
>3uoa_B Mucosa-associated lymphoid tissue lymphoma transl protein 1; paracaspase, lymphoma, NF-KB signalling, caspase fold, immun fold, hydrolase-hydrolase inhibitor complex; 1.75A {Homo sapiens} PDB: 3uo8_B 3v55_A 3v4l_A* 3v4o_A* Back     alignment and structure
>3bij_A Uncharacterized protein GSU0716; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.50A {Geobacter sulfurreducens pca} Back     alignment and structure
>1sc3_B Interleukin-1 beta convertase; malonate-bound caspase-1, hydrolase; 1.80A {Homo sapiens} SCOP: c.17.1.1 PDB: 1ice_B 1bmq_B* 1rwm_B* 1rwk_B* 1rwo_B* 1rwp_B* 1rwv_B* 1rww_B* 1rwn_B* 1sc1_B 1rwx_B 1sc4_B 2h4y_B* 2hbq_B* 2hbr_B* 3ns7_B* 3d6f_B* 3d6h_B* 3d6m_B* 2h4w_B* ... Back     alignment and structure
>3rjm_B Caspase-2; caspase-2, caspase, hydrolase-hydrolase inhibitor; HET: 3PX; 2.55A {Homo sapiens} Back     alignment and structure
>3h11_B Caspase-8; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} SCOP: c.17.1.1 PDB: 2k7z_A 1i4e_B 2fun_B 2c2z_B* Back     alignment and structure
>1pyo_B Caspase-2; apoptosis, caspase, alpha-beta, thiol protease, hydrolase-HY inhibitor complex; 1.65A {Homo sapiens} SCOP: c.17.1.1 PDB: 2p2c_B 3r5j_B 3r6g_B 3r7b_B 3r7n_B 3r7s_B 3r6l_B Back     alignment and structure
>3sir_A Caspase; hydrolase; 2.68A {Drosophila melanogaster} PDB: 3sip_A Back     alignment and structure
>1qtn_B Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_B* 3kjq_B* 2y1l_B 1f9e_B* 1qdu_B* Back     alignment and structure
>1m72_A Caspase-1; caspase, cysteine protease, hydrolase-hydrolase inhibitor CO; 2.30A {Spodoptera frugiperda} SCOP: c.17.1.1 PDB: 3sip_B Back     alignment and structure
>4f6o_A Metacaspase-1; rossmann fold, hydrolase; HET: DFH; 1.68A {Saccharomyces cerevisiae} Back     alignment and structure
>3od5_A Caspase-6; caspase domain, apoptotic protease, hydrolase-hydrolase INHI complex; 1.60A {Homo sapiens} SCOP: c.17.1.0 PDB: 3k7e_A 3s70_A 3v6m_A 3v6l_A 3nr2_A 4fxo_A 2wdp_A 3nkf_A 3s8e_A 4ejf_A 3qnw_A* 3p4u_A* 3p45_B 3qnw_B* 3p4u_B* Back     alignment and structure
>1nw9_B Caspase 9, apoptosis-related cysteine protease; XIAP, caspase inhibition, caspase activation, dimerization; 2.40A {Homo sapiens} SCOP: c.17.1.1 PDB: 1jxq_A* 2ar9_A Back     alignment and structure
>2xzd_B Caspase-3; hydrolase-protein binding complex, de novo protein, apoptosi ankyrin repeat protein, ribosome display; 2.10A {Homo sapiens} PDB: 2xzt_B 2y0b_B Back     alignment and structure
>4af8_A Metacaspase MCA2; hydrolase, cysteine peptidase, caspase/hemoglobin fold; 1.40A {Trypanosoma brucei} PDB: 4afp_A 4afv_A 4afr_A Back     alignment and structure
>2fp3_A Caspase NC; apoptosis, initiator caspase activation, dimerization, active site conformation, hydrolysis/apoptosis complex; 2.50A {Drosophila melanogaster} Back     alignment and structure
>4ehd_A Caspase-3; caspase, apoptosis, allosteric inhibition; 1.58A {Homo sapiens} PDB: 4ehk_A 4ehf_A 4ehn_A 1cp3_A 4ehh_A 4eha_A 4ehl_A 1i3o_A Back     alignment and structure
>3h11_A CAsp8 and FADD-like apoptosis regulator; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 3h13_A Back     alignment and structure
>2ql9_B Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_B* 2ql5_B* 2qlb_B* 2qlf_B 2qlj_B* 3edr_B 3ibc_B 3ibf_B 1i51_B Back     alignment and structure
>2j32_A Caspase-3; Pro-caspase3, thiol protease, hydrolase, hydrolase-hydrolase inhibitor complex; 1.30A {Homo sapiens} PDB: 2j30_A 3h0e_A* 2j33_A 3pd1_A 2j31_A 3pcx_A 1nms_A* 1nmq_A* 3deh_A* 3dei_A* 3dej_A* 3dek_A* 3pd0_A 3itn_A 1qx3_A Back     alignment and structure
>2nn3_C Caspase-1; cysteine protease, hydrolase; 3.00A {Spodoptera frugiperda} Back     alignment and structure
>2dko_B Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 2c2k_B* 2c2m_B* 2c2o_B* 2c1e_B* 2cdr_B* 2cnk_B* 2cnl_B* 2cnn_B* 2cno_B* 2cjy_B 1pau_B 1re1_B* 1rhk_B* 1rhm_B* 1rhq_B* 1rhr_B* 1rhu_B* 1rhj_B* 1i3o_B* 3edq_B ... Back     alignment and structure
>1sc3_B Interleukin-1 beta convertase; malonate-bound caspase-1, hydrolase; 1.80A {Homo sapiens} SCOP: c.17.1.1 PDB: 1ice_B 1bmq_B* 1rwm_B* 1rwk_B* 1rwo_B* 1rwp_B* 1rwv_B* 1rww_B* 1rwn_B* 1sc1_B 1rwx_B 1sc4_B 2h4y_B* 2hbq_B* 2hbr_B* 3ns7_B* 3d6f_B* 3d6h_B* 3d6m_B* 2h4w_B* ... Back     alignment and structure
>1f1j_A Caspase-7 protease; caspase-7, cysteine protease, hydrolase, apoptosis, hydrolas hydrolase inhibitor complex; 2.35A {Homo sapiens} SCOP: c.17.1.1 PDB: 1kmc_A 3r5k_A 1i4o_A 1gqf_A 3h1p_A 1shj_A* 1k86_A 1k88_A 1shl_A* Back     alignment and structure
>3e4c_A Caspase-1; zymogen, inflammasome, ICE, IL-1B, innate immunity, apoptosis, hydrolase, protease protease; 2.05A {Homo sapiens} Back     alignment and structure
>1qtn_B Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_B* 3kjq_B* 2y1l_B 1f9e_B* 1qdu_B* Back     alignment and structure
>1pyo_B Caspase-2; apoptosis, caspase, alpha-beta, thiol protease, hydrolase-HY inhibitor complex; 1.65A {Homo sapiens} SCOP: c.17.1.1 PDB: 2p2c_B 3r5j_B 3r6g_B 3r7b_B 3r7n_B 3r7s_B 3r6l_B Back     alignment and structure
>2ql9_B Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_B* 2ql5_B* 2qlb_B* 2qlf_B 2qlj_B* 3edr_B 3ibc_B 3ibf_B 1i51_B Back     alignment and structure
>2dko_B Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 2c2k_B* 2c2m_B* 2c2o_B* 2c1e_B* 2cdr_B* 2cnk_B* 2cnl_B* 2cnn_B* 2cno_B* 2cjy_B 1pau_B 1re1_B* 1rhk_B* 1rhm_B* 1rhq_B* 1rhr_B* 1rhu_B* 1rhj_B* 1i3o_B* 3edq_B ... Back     alignment and structure
>3uoa_B Mucosa-associated lymphoid tissue lymphoma transl protein 1; paracaspase, lymphoma, NF-KB signalling, caspase fold, immun fold, hydrolase-hydrolase inhibitor complex; 1.75A {Homo sapiens} PDB: 3uo8_B 3v55_A 3v4l_A* 3v4o_A* Back     alignment and structure
>3rjm_B Caspase-2; caspase-2, caspase, hydrolase-hydrolase inhibitor; HET: 3PX; 2.55A {Homo sapiens} Back     alignment and structure
>2xzd_B Caspase-3; hydrolase-protein binding complex, de novo protein, apoptosi ankyrin repeat protein, ribosome display; 2.10A {Homo sapiens} PDB: 2xzt_B 2y0b_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 245
d1m72a_256 c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera 1e-47
d1f1ja_245 c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [Tax 1e-40
g1nme.1238 c.17.1.1 (A:,B:) Apopain (caspase-3, cpp32) {Human 1e-38
d1nw9b_277 c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [Tax 3e-34
g1qtn.1242 c.17.1.1 (A:,B:) Caspase-8 {Human (Homo sapiens) [ 2e-33
g1pyo.1257 c.17.1.1 (A:,B:) Caspase-2 {Human (Homo sapiens) [ 9e-32
g1sc3.1261 c.17.1.1 (A:,B:) Interleukin-1beta converting enzy 1e-24
>d1m72a_ c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Caspase-like
superfamily: Caspase-like
family: Caspase catalytic domain
domain: Caspase-1
species: Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]

 Score =  156 bits (395), Expect = 1e-47
 Identities = 81/187 (43%), Positives = 112/187 (59%), Gaps = 14/187 (7%)

Query: 8   MPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVY 67
           MPV +++  YNM+H  RG A++FNH+ F + ++  R G+  D  NL      LGF+V+V+
Sbjct: 5   MPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVF 64

Query: 68  TNPEFREITEILSNLSQEDHSDADCLVITVLTHGLGEQ-----------KLWLPFTADKC 116
            N +  EI + +   ++ DHSDADCL++ VLTHG                LW  FTADKC
Sbjct: 65  PNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKC 124

Query: 117 RTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAGVNAYKIPSYADFLIAYSTVEDSL 176
            TLAGKPK+FFIQAC+G +LDGG+ L         +   +Y+IP +ADFLIA+STV    
Sbjct: 125 PTLAGKPKLFFIQACQGDRLDGGITL--SRTETDGSPSTSYRIPVHADFLIAFSTVPGY- 181

Query: 177 LACRGTK 183
            + R T 
Sbjct: 182 FSWRNTT 188
>d1f1ja_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1nw9b_ c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
d1m72a_256 Caspase-1 {Fall armyworm (Spodoptera frugiperda) [ 100.0
d1f1ja_245 Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} 100.0
g1pyo.1257 Caspase-2 {Human (Homo sapiens) [TaxId: 9606]} 100.0
g1nme.1238 Apopain (caspase-3, cpp32) {Human (Homo sapiens) [ 100.0
g1sc3.1261 Interleukin-1beta converting enzyme (a cysteine pr 100.0
g1qtn.1242 Caspase-8 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1nw9b_277 Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1f1ja_245 Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} 97.74
d1m72a_256 Caspase-1 {Fall armyworm (Spodoptera frugiperda) [ 97.72
g1nme.1238 Apopain (caspase-3, cpp32) {Human (Homo sapiens) [ 97.16
g1pyo.1257 Caspase-2 {Human (Homo sapiens) [TaxId: 9606]} 97.05
g1qtn.1242 Caspase-8 {Human (Homo sapiens) [TaxId: 9606]} 96.94
g1sc3.1261 Interleukin-1beta converting enzyme (a cysteine pr 95.74
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 82.56
d1nw9b_277 Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} 82.29
d1edza2146 Tetrahydrofolate dehydrogenase/cyclohydrolase {Bak 80.95
>d1m72a_ c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Caspase-like
superfamily: Caspase-like
family: Caspase catalytic domain
domain: Caspase-1
species: Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]

Probab=100.00  E-value=5.9e-47  Score=329.25  Aligned_cols=180  Identities=45%  Similarity=0.795  Sum_probs=156.2

Q ss_pred             cCCCCCCCCCcccCCCCCceEEEEEeCCCCCCCCCCCCCCcHHHHHHHHHHHHhCCcEEEEEeCCCHHHHHHHHHHHhhh
Q psy13938          6 VPMPVAKDSAEYNMSHPRRGRALVFNHDEFQMDNMTPRPGSGADVKNLEAAFYALGFEVSVYTNPEFREITEILSNLSQE   85 (245)
Q Consensus         6 ~~~~~~~~~~~Y~m~~~~~G~aLIInn~~F~~~~~~~R~Gs~~D~~~l~~~f~~LgF~V~~~~nlt~~em~~~l~~~~~~   85 (245)
                      +.+|+++.++.|+|++.|+|+||||||.+|....+++|.||++|+++|+++|++|||+|.++.|+|.++|.+.|+++++.
T Consensus         3 ~~~~~~~~~~~Y~m~~~~rG~aLIInN~~f~~~~~~~r~g~~~Da~~l~~~l~~lGF~V~~~~nlt~~~m~~~l~~~~~~   82 (256)
T d1m72a_           3 ARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEM   82 (256)
T ss_dssp             EECCSCTTCSBCCCCSSEEEEEEEEECCCCSSTTCCCCTTHHHHHHHHHHHHHHTTCEEEEEESCCHHHHHHHHHHHHTS
T ss_pred             cccCCCCCCCEecCCCCCccEEEEEeCCccCCCCCCCCCChHHHHHHHHHHHHHCCCEEEEEeCCCHHHHHHHHHHHhhh
Confidence            46899999999999999999999999999987678999999999999999999999999999999999999999999988


Q ss_pred             cCCCCceEEEEeccCCcc-----------hhhhhhccccccccccCCCceEEEEecccCcccCCCeeeecCCCcccccCC
Q psy13938         86 DHSDADCLVITVLTHGLG-----------EQKLWLPFTADKCRTLAGKPKIFFIQACRGTKLDGGVRLVSRANTETDAGV  154 (245)
Q Consensus        86 ~~~~~d~~vv~ilSHG~~-----------i~~I~~~f~~~~c~~L~~KPKlf~iQACRG~~~~~gv~~~d~~~~e~~~~~  154 (245)
                      .|.++||++|+|||||.+           +++++..|....||.|++||||||||||||++.+.|+...+..  ......
T Consensus        83 ~~~~~d~~vv~~~~HG~~~~i~~~D~~~~~~~~~~~~~~~~~~~L~~KPKif~lqACRg~~~~~~~~~~~~~--~~~~~~  160 (256)
T d1m72a_          83 DHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSRTE--TDGSPS  160 (256)
T ss_dssp             CCTTEEEEEEEEESCEETTEEECSSSEECTTHHHHTTSTTTCGGGTTSCEEEEEESCSSSBCBCCEEEEC----------
T ss_pred             hccCCCeEEEEEeccCcCCEEEecCCcccchHHhhhhhhhhhHHHcCCcEEEEEecCcCCcccCCccccccc--cccccc
Confidence            889999999999999987           7899999999999999999999999999999999887664321  011022


Q ss_pred             CCcCCCCCCCeEEEecccCCchhhccCccccCcEE
Q psy13938        155 NAYKIPSYADFLIAYSTVEDSLLACRGTKLDGGVR  189 (245)
Q Consensus       155 ~~~~ip~~~D~li~ysT~pg~~~~~~g~~~d~gv~  189 (245)
                      ....+|..+|++++|||.||+++++...  .++|.
T Consensus       161 ~~~~~p~~~d~lia~st~~g~~a~~~~~--~gS~f  193 (256)
T d1m72a_         161 TSYRIPVHADFLIAFSTVPGYFSWRNTT--RGSWF  193 (256)
T ss_dssp             -CEEECTTCSEEEEESSCTTBCCEEETT--TEEHH
T ss_pred             cccccCCCCCeeEEEecccceeeccCCC--CCCHH
Confidence            3556889999999999999999996432  24554
>d1f1ja_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw9b_ c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ja_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m72a_ c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw9b_ c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure