Diaphorina citri psyllid: psy13939


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MSGDYELSKMYYKFDEEDDDDVFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQI
ccccccccccEEEcccccccccccccCEEEccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccc
************KFDEEDDDDVFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYN************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGDYELSKMYYKFDEEDDDDVFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0043068 [BP]positive regulation of programmed cell deathprobableGO:0050794, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0050789, GO:0048522
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0012501 [BP]programmed cell deathprobableGO:0010259, GO:0009987, GO:0008150, GO:0044763, GO:0007569, GO:0044699
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0035103 [BP]sterol regulatory element binding protein cleavageprobableGO:0044238, GO:0019219, GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0051173, GO:0031323, GO:0010628, GO:0023052, GO:0007165, GO:0045935, GO:0050789, GO:0044699, GO:0080090, GO:0044267, GO:0051716, GO:0010604, GO:0044260, GO:0051171, GO:0009891, GO:2000112, GO:0071704, GO:0010467, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0032933, GO:0006984, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0008150, GO:0045893, GO:0008152, GO:2001141, GO:0016485, GO:0007154, GO:0044700, GO:0071501, GO:0051604, GO:0006991, GO:0019538, GO:0050896, GO:0051252, GO:0051254, GO:0044237, GO:0043170, GO:0006355, GO:0010557, GO:0006357, GO:0045944, GO:0033554, GO:0044763, GO:0048522

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SIR, chain A
Confidence level:very confident
Coverage over the Query: 11-71
View the alignment between query and template
View the model in PyMOL