Psyllid ID: psy13939

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MSGDYELSKMYYKFDEEDDDDVFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQI
ccccccccccEEEcccccccccccccEEEEccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccc
ccccccccccEEEccccccEEEEEEEcccEEcccEEHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccHcccccc
MSGDYELSKMYykfdeeddddvfvsfyswrhpengtWFIQCLCQELadsgtkldLLSIMTRVSRRVALDMESYNDLLSWQHQQKQI
MSGDYELSKMYYKFDEEDDDDVFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYndllswqhqqkqi
MSGDYELSKMYYKfdeeddddvfvSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQI
*********************VFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSW*******
************KFDEEDDDDVFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDME*YN*****QHQQKQI
MSGDYELSKMYYKFDEEDDDDVFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLL*********
********KMYYKFDEEDDDDVFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESY*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGDYELSKMYYKFDEEDDDDVFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query86 2.2.26 [Sep-21-2011]
O01382339 Caspase OS=Drosophila mel yes N/A 0.918 0.233 0.457 1e-12
P89116299 Caspase-1 OS=Spodoptera f N/A N/A 0.720 0.207 0.451 1e-10
Q60431277 Caspase-3 OS=Mesocricetus N/A N/A 0.709 0.220 0.483 2e-10
Q8MJC3277 Caspase-3 OS=Oryctolagus yes N/A 0.709 0.220 0.483 3e-10
Q08DY9275 Caspase-3 OS=Bos taurus G yes N/A 0.697 0.218 0.442 5e-10
O02002323 Caspase-1 OS=Drosophila m no N/A 0.709 0.188 0.459 1e-09
Q95ND5277 Caspase-3 OS=Sus scrofa G yes N/A 0.709 0.220 0.451 2e-09
P55210303 Caspase-7 OS=Homo sapiens yes N/A 0.709 0.201 0.451 2e-09
P70677277 Caspase-3 OS=Mus musculus yes N/A 0.709 0.220 0.467 4e-09
Q2PFV2277 Caspase-3 OS=Macaca fasci N/A N/A 0.709 0.220 0.451 4e-09
>sp|O01382|ICE_DROME Caspase OS=Drosophila melanogaster GN=Ice PE=1 SV=2 Back     alignment and function desciption
 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 50/83 (60%), Gaps = 4/83 (4%)

Query: 8   SKMYYKFDEEDDDDVFVS----FYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVS 63
           S M YK     D  +  S    FYSWR+   G+WF+Q LC ELA +G +LD+L+++T V 
Sbjct: 233 SSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVC 292

Query: 64  RRVALDMESYNDLLSWQHQQKQI 86
           +RVA+D ES        HQQKQI
Sbjct: 293 QRVAVDFESCTPDTPEMHQQKQI 315
Involved in the activation cascade of caspases responsible for apoptosis execution. Acts downstream of rpr. Cleaves baculovirus p35 and lamin DmO in vitro.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: -
>sp|P89116|CASP1_SPOFR Caspase-1 OS=Spodoptera frugiperda PE=1 SV=1 Back     alignment and function description
>sp|Q60431|CASP3_MESAU Caspase-3 OS=Mesocricetus auratus GN=CASP3 PE=2 SV=1 Back     alignment and function description
>sp|Q8MJC3|CASP3_RABIT Caspase-3 OS=Oryctolagus cuniculus GN=CASP3 PE=2 SV=1 Back     alignment and function description
>sp|Q08DY9|CASP3_BOVIN Caspase-3 OS=Bos taurus GN=CASP3 PE=2 SV=1 Back     alignment and function description
>sp|O02002|CASP1_DROME Caspase-1 OS=Drosophila melanogaster GN=Dcp-1 PE=1 SV=1 Back     alignment and function description
>sp|Q95ND5|CASP3_PIG Caspase-3 OS=Sus scrofa GN=CASP3 PE=1 SV=1 Back     alignment and function description
>sp|P55210|CASP7_HUMAN Caspase-7 OS=Homo sapiens GN=CASP7 PE=1 SV=1 Back     alignment and function description
>sp|P70677|CASP3_MOUSE Caspase-3 OS=Mus musculus GN=Casp3 PE=1 SV=1 Back     alignment and function description
>sp|Q2PFV2|CASP3_MACFA Caspase-3 OS=Macaca fascicularis GN=CASP3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
328708695 448 PREDICTED: caspase-1-like isoform 2 [Acy 0.709 0.136 0.661 3e-15
350424534 306 PREDICTED: caspase-like [Bombus impatien 0.720 0.202 0.532 1e-11
195053480 294 GH19945 [Drosophila grimshawi] gi|193895 0.906 0.265 0.475 1e-11
198452868 344 GA20588 [Drosophila pseudoobscura pseudo 0.918 0.229 0.469 2e-11
1929040 339 drICE protein [Drosophila melanogaster] 0.918 0.233 0.469 2e-11
157131552178 caspase-1 [Aedes aegypti] 0.895 0.432 0.469 2e-11
195445154 255 GK11927 [Drosophila willistoni] gi|19416 0.720 0.243 0.483 2e-11
403183264180 AAEL012143-PA, partial [Aedes aegypti] 0.895 0.427 0.469 2e-11
195144464 344 GL23515 [Drosophila persimilis] gi|19410 0.918 0.229 0.469 3e-11
289724893 334 caspase [Glossina morsitans morsitans] 0.918 0.236 0.469 3e-11
>gi|328708695|ref|XP_003243774.1| PREDICTED: caspase-1-like isoform 2 [Acyrthosiphon pisum] gi|328708697|ref|XP_001950891.2| PREDICTED: caspase-1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 1/62 (1%)

Query: 26  FYSWRHPENGTWFIQCLCQEL-ADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQK 84
           +YS+RHPENGTWFIQ LC E+     +  DLL IMTRVSRRVALD ESYN    W H+QK
Sbjct: 356 YYSFRHPENGTWFIQSLCSEMNKHDHSNSDLLGIMTRVSRRVALDHESYNPDEPWLHKQK 415

Query: 85  QI 86
           QI
Sbjct: 416 QI 417

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350424534|ref|XP_003493826.1| PREDICTED: caspase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|195053480|ref|XP_001993654.1| GH19945 [Drosophila grimshawi] gi|193895524|gb|EDV94390.1| GH19945 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|198452868|ref|XP_001358977.2| GA20588 [Drosophila pseudoobscura pseudoobscura] gi|198132112|gb|EAL28120.2| GA20588 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|1929040|emb|CAA72937.1| drICE protein [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|157131552|ref|XP_001655876.1| caspase-1 [Aedes aegypti] Back     alignment and taxonomy information
>gi|195445154|ref|XP_002070198.1| GK11927 [Drosophila willistoni] gi|194166283|gb|EDW81184.1| GK11927 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|403183264|gb|EAT35718.2| AAEL012143-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|195144464|ref|XP_002013216.1| GL23515 [Drosophila persimilis] gi|194102159|gb|EDW24202.1| GL23515 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|289724893|gb|ADD18379.1| caspase [Glossina morsitans morsitans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
FB|FBgn0019972339 Ice "Ice" [Drosophila melanoga 0.709 0.179 0.524 3.9e-12
UNIPROTKB|F1MD58277 CASP7 "Uncharacterized protein 0.697 0.216 0.475 1.2e-10
UNIPROTKB|E2R027300 CASP7 "Uncharacterized protein 0.697 0.2 0.475 1.2e-10
ZFIN|ZDB-GENE-011210-1282 casp3a "caspase 3, apoptosis-r 0.697 0.212 0.475 1.3e-10
UNIPROTKB|Q08DY9275 CASP3 "Caspase-3" [Bos taurus 0.697 0.218 0.442 1.5e-10
UNIPROTKB|F1MB04275 CASP3 "Caspase-3 subunit p17" 0.697 0.218 0.442 2.6e-10
UNIPROTKB|Q95ND5277 CASP3 "Caspase-3" [Sus scrofa 0.697 0.216 0.459 4.5e-10
UNIPROTKB|P55210303 CASP7 "Caspase-7" [Homo sapien 0.697 0.198 0.459 6e-10
MGI|MGI:107739277 Casp3 "caspase 3" [Mus musculu 0.697 0.216 0.475 9.9e-10
UNIPROTKB|P42574277 CASP3 "Caspase-3" [Homo sapien 0.697 0.216 0.442 1.3e-09
FB|FBgn0019972 Ice "Ice" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 168 (64.2 bits), Expect = 3.9e-12, P = 3.9e-12
 Identities = 32/61 (52%), Positives = 43/61 (70%)

Query:    26 FYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQ 85
             FYSWR+   G+WF+Q LC ELA +G +LD+L+++T V +RVA+D ES        HQQKQ
Sbjct:   255 FYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQ 314

Query:    86 I 86
             I
Sbjct:   315 I 315
GO:0004197 "cysteine-type endopeptidase activity" evidence=ISS;IDA;TAS
GO:0006915 "apoptotic process" evidence=TAS
GO:0046668 "regulation of retinal cell programmed cell death" evidence=NAS
GO:0006508 "proteolysis" evidence=IEA;TAS
GO:0012501 "programmed cell death" evidence=IDA;IMP
GO:0048515 "spermatid differentiation" evidence=IMP
GO:0010165 "response to X-ray" evidence=IMP
GO:0035070 "salivary gland histolysis" evidence=IMP
GO:0046672 "positive regulation of compound eye retinal cell programmed cell death" evidence=IMP
GO:0010623 "developmental programmed cell death" evidence=IMP
GO:0045476 "nurse cell apoptotic process" evidence=IGI
GO:0035103 "sterol regulatory element binding protein cleavage" evidence=IDA
GO:0016322 "neuron remodeling" evidence=IMP
UNIPROTKB|F1MD58 CASP7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R027 CASP7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-011210-1 casp3a "caspase 3, apoptosis-related cysteine protease a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DY9 CASP3 "Caspase-3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MB04 CASP3 "Caspase-3 subunit p17" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q95ND5 CASP3 "Caspase-3" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P55210 CASP7 "Caspase-7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:107739 Casp3 "caspase 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P42574 CASP3 "Caspase-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
cd00032243 cd00032, CASc, Caspase, interleukin-1 beta convert 1e-17
smart00115241 smart00115, CASc, Caspase, interleukin-1 beta conv 1e-15
pfam00656228 pfam00656, Peptidase_C14, Caspase domain 6e-14
>gnl|CDD|237997 cd00032, CASc, Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis) Back     alignment and domain information 
 Score = 73.8 bits (182), Expect = 1e-17
 Identities = 26/61 (42%), Positives = 37/61 (60%), Gaps = 7/61 (11%)

Query: 26  FYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQ 85
           + SWR+ + G+WFIQ LCQ L      LDLL I+T+V+R+VA   ES        + +KQ
Sbjct: 176 YVSWRNTKKGSWFIQSLCQVLRKYAHSLDLLDILTKVNRKVAEKFES-------VNGKKQ 228

Query: 86  I 86
           +
Sbjct: 229 M 229

Caspases are synthesized as inactive zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologs. Length = 243
>gnl|CDD|214521 smart00115, CASc, Caspase, interleukin-1 beta converting enzyme (ICE) homologues Back     alignment and domain information
>gnl|CDD|216047 pfam00656, Peptidase_C14, Caspase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 86
KOG3573|consensus300 99.85
smart00115241 CASc Caspase, interleukin-1 beta converting enzyme 99.84
cd00032243 CASc Caspase, interleukin-1 beta converting enzyme 99.8
PF00656248 Peptidase_C14: Caspase domain; InterPro: IPR011600 98.03
PF03500144 Cellsynth_D: Cellulose synthase subunit D; InterPr 81.87
cd00512399 MM_CoA_mutase Coenzyme B12-dependent-methylmalonyl 81.46
cd03677424 MM_CoA_mutase_beta Coenzyme B12-dependent-methylma 80.86
>KOG3573|consensus Back     alignment and domain information 
Probab=99.85  E-value=6.1e-22  Score=147.44  Aligned_cols=74  Identities=35%  Similarity=0.614  Sum_probs=64.0

Q ss_pred             ccccccCCCCCCccc----cCCCccccCCCCCchHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHhhhhccCCCcccccc
Q psy13939          7 LSKMYYKFDEEDDDD----VFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQ   82 (86)
Q Consensus         7 ~~~~~~~iP~~aD~L----T~~g~~s~R~~~~GSwFIq~Lc~vl~~~~~~~dl~~ilt~Vn~~Va~~~~s~~~~~~~~~~   82 (86)
                      .....+.||.+||||    |+|||+||||+..||||||+||++|.++++. ||++||++||++|..  ...   -+..++
T Consensus       208 ~~~~~~~ips~aD~L~~~st~~g~~s~R~~~~gsw~Iq~Lc~~~~~~~~~-~l~~ll~~v~~~~~~--~~~---~~~~~~  281 (300)
T KOG3573|consen  208 DDDATYKIPSEADFLVSYSTTPGYVSWRDPTKGSWFIQSLCEVLQEYAKS-DLLDLLTEVNRKVSF--SFD---VPGGNA  281 (300)
T ss_pred             ccchhccCccccceeEeeecCCCceeeecCCCceeeHHHHHHHHHHhcch-hHHHHHHHHHHhhhc--ccc---cccccc
Confidence            345678899999999    9999999999999999999999999999998 999999999999642  121   157788


Q ss_pred             ccCC
Q psy13939         83 QKQI   86 (86)
Q Consensus        83 ~KQm   86 (86)
                      .|||
T Consensus       282 ~kq~  285 (300)
T KOG3573|consen  282 QKQM  285 (300)
T ss_pred             cccC
Confidence            8886

>smart00115 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues Back     alignment and domain information
>cd00032 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis) Back     alignment and domain information
>PF00656 Peptidase_C14: Caspase domain; InterPro: IPR011600 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03500 Cellsynth_D: Cellulose synthase subunit D; InterPro: IPR022798 Cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues, is the major component of wood and thus paper, and is synthesized by plants, most algae, some bacteria and fungi, and even some animals Back     alignment and domain information
>cd00512 MM_CoA_mutase Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM)-like family; contains proteins similar to MCM, and the large subunit of Streptomyces coenzyme B12-dependent isobutyryl-CoA mutase (ICM) Back     alignment and domain information
>cd03677 MM_CoA_mutase_beta Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM) family, Beta subunit-like subfamily; contains bacterial proteins similar to the beta subunit of MCMs from Propionbacterium shermanni and Streptomyces cinnamonensis, which are alpha/beta heterodimers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
3sip_B109 Crystal Structure Of Drice And Diap1-Bir1 Complex L 2e-13
3sir_A259 Crystal Structure Of Drice Length = 259 2e-13
1m72_A272 Crystal Structure Of Caspase-1 From Spodoptera Frug 1e-11
2nn3_C310 Structure Of Pro-Sf-Caspase-1 Length = 310 1e-11
1i4o_A280 Crystal Structure Of The XiapCASPASE-7 Complex Leng 5e-11
1gqf_B265 Crystal Structure Of Human Procaspase-7 Length = 26 6e-11
1shj_A262 Caspase-7 In Complex With Dica Allosteric Inhibitor 6e-11
3h1p_A260 Mature Caspase-7 I213a With Devd-Cho Inhibitor Boun 6e-11
1kmc_A303 Crystal Structure Of The Caspase-7 XIAP-Bir2 Comple 6e-11
4fdl_A305 Crystal Structure Of Caspase-7 Length = 305 6e-11
1f1j_A305 Crystal Structure Of Caspase-7 In Complex With Acet 7e-11
1k88_A253 Crystal Structure Of Procaspase-7 Length = 253 2e-10
1i51_B105 Crystal Structure Of Caspase-7 Complexed With Xiap 2e-10
2j33_A250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 2e-10
2ql5_B97 Crystal Structure Of Caspase-7 With Inhibitor Ac-Dm 2e-10
1k86_A253 Crystal Structure Of Caspase-7 Length = 253 2e-10
4ehk_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 2e-10
4fea_A247 Crystal Structure Of Caspase-7 In Complex With Allo 2e-10
4ehd_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 2e-10
1shl_A245 Caspase-7 In Complex With Fica Allosteric Inhibitor 2e-10
4ehn_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 2e-10
4ehh_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 3e-10
2xyg_B93 Caspase-3:cas329306 Length = 93 4e-10
1nme_B92 Structure Of Casp-3 With Tethered Salicylate Length 4e-10
2cjx_B103 Extended Substrate Recognition In Caspase-3 Reveale 4e-10
2cjy_B103 Extended Substrate Recognition In Caspase-3 Reveale 4e-10
3edq_B108 Crystal Structure Of Caspase-3 With Inhibitor Ac-Ld 4e-10
2h5i_B95 Crystal Structure Of Caspase-3 With Inhibitor Ac-De 4e-10
2xzd_B118 Caspase-3 In Complex With An Inhibitory Darpin-3.4 5e-10
1i3o_B110 Crystal Structure Of The Complex Of Xiap-Bir2 And C 5e-10
1pau_B102 Crystal Structure Of The Complex Of Apopain With Th 5e-10
1gfw_B97 The 2.8 Angstrom Crystal Structure Of Caspase-3 (Ap 5e-10
3kjf_B109 Caspase 3 Bound To A Covalent Inhibitor Length = 10 5e-10
3deh_A249 Crystal Structures Of Caspase-3 With Bound Isoquino 6e-10
3h0e_A255 3,4-Dihydropyrimido(1,2-A)indol-10(2h)-Ones As Pote 6e-10
4ehl_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 6e-10
1cp3_A277 Crystal Structure Of The Complex Of Apopain With Th 6e-10
2j32_A250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 6e-10
2j31_A250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 6e-10
4eha_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 6e-10
2j30_A250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 6e-10
3itn_A250 Crystal Structure Of Pseudo-Activated Procaspase-3 6e-10
1nmq_A249 Extendend Tethering: In Situ Assembly Of Inhibitors 6e-10
1qx3_A257 Conformational Restrictions In The Active Site Of U 7e-10
4ehf_A277 Allosteric Modulation Of Caspase-3 Through Mutagene 7e-10
3r5k_A312 A Designed Redox-Controlled Caspase-7 Length = 312 1e-09
3pd0_A250 Caspase-3 E246a Length = 250 1e-09
3pd1_A250 Caspase-3 K242a Length = 250 2e-09
3pcx_A250 Caspase-3 E246a, K242a Double Mutant Length = 250 3e-09
4fxo_A299 Zinc-Mediated Allosteric Inhibiton Of Caspase-6 Len 4e-05
2wdp_A293 Crystal Structure Of Ligand Free Human Caspase-6 Le 4e-05
4ejf_A279 Allosteric Peptides That Bind To A Caspase Zymogen 4e-05
3nr2_A294 Crystal Structure Of Caspase-6 Zymogen Length = 294 4e-05
3k7e_A278 Crystal Structure Of Human Ligand-Free Mature Caspa 4e-05
3nkf_A277 Crystal Structure Of Human Ligand-Free Mature Caspa 5e-05
3s8e_A277 Phosphorylation Regulates Assembly Of The Caspase-6 6e-05
3v6m_A279 Inhibition Of Caspase-6 Activity By Single Mutation 6e-05
3v6l_A282 Crystal Structure Of Caspase-6 Inactivation Mutatio 7e-05
3p4u_B108 Crystal Structure Of Active Caspase-6 In Complex Wi 1e-04
3qnw_B100 Caspase-6 In Complex With Z-Vad-Fmk Inhibitor Lengt 2e-04
3p45_B108 Crystal Structure Of Apo-Caspase-6 At Physiological 2e-04
2k7z_A266 Solution Structure Of The Catalytic Domain Of Proca 5e-04
2c2z_B106 Crystal Structure Of Caspase-8 In Complex With Aza- 5e-04
3h11_B271 Zymogen Caspase-8:c-Flipl Protease Domain Complex L 5e-04
2y1l_B104 Caspase-8 In Complex With Darpin-8.4 Length = 104 5e-04
1i4e_B258 Crystal Structure Of The Caspase-8P35 COMPLEX Lengt 5e-04
1qtn_B95 Crystal Structure Of The Complex Of Caspase-8 With 6e-04
1qdu_B88 Crystal Structure Of The Complex Of Caspase-8 With 6e-04
1f9e_B89 Caspase-8 Specificity Probed At Subsite S4: Crystal 7e-04
>pdb|3SIP|B Chain B, Crystal Structure Of Drice And Diap1-Bir1 Complex Length = 109 Back     alignment and structure 
Iteration: 1

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%)
Query: 26 FYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQ 85
          FYSWR+   G+WF+Q LC ELA +G +LD+L+++T V +RVA+D ES        HQQKQ
Sbjct: 25 FYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQ 84
Query: 86 I 86
          I
Sbjct: 85 I 85
>pdb|3SIR|A Chain A, Crystal Structure Of Drice Length = 259 Back     alignment and structure
>pdb|1M72|A Chain A, Crystal Structure Of Caspase-1 From Spodoptera Frugiperda Length = 272 Back     alignment and structure
>pdb|2NN3|C Chain C, Structure Of Pro-Sf-Caspase-1 Length = 310 Back     alignment and structure
>pdb|1I4O|A Chain A, Crystal Structure Of The XiapCASPASE-7 Complex Length = 280 Back     alignment and structure
>pdb|1SHJ|A Chain A, Caspase-7 In Complex With Dica Allosteric Inhibitor Length = 262 Back     alignment and structure
>pdb|3H1P|A Chain A, Mature Caspase-7 I213a With Devd-Cho Inhibitor Bound To Active Site Length = 260 Back     alignment and structure
>pdb|1KMC|A Chain A, Crystal Structure Of The Caspase-7 XIAP-Bir2 Complex Length = 303 Back     alignment and structure
>pdb|4FDL|A Chain A, Crystal Structure Of Caspase-7 Length = 305 Back     alignment and structure
>pdb|1F1J|A Chain A, Crystal Structure Of Caspase-7 In Complex With Acetyl-asp-glu-val-asp- Cho Length = 305 Back     alignment and structure
>pdb|1K88|A Chain A, Crystal Structure Of Procaspase-7 Length = 253 Back     alignment and structure
>pdb|1I51|B Chain B, Crystal Structure Of Caspase-7 Complexed With Xiap Length = 105 Back     alignment and structure
>pdb|2J33|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of (Pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|2QL5|B Chain B, Crystal Structure Of Caspase-7 With Inhibitor Ac-Dmqd-Cho Length = 97 Back     alignment and structure
>pdb|1K86|A Chain A, Crystal Structure Of Caspase-7 Length = 253 Back     alignment and structure
>pdb|4EHK|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|4FEA|A Chain A, Crystal Structure Of Caspase-7 In Complex With Allosteric Inhibitor Length = 247 Back     alignment and structure
>pdb|4EHD|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|1SHL|A Chain A, Caspase-7 In Complex With Fica Allosteric Inhibitor Length = 245 Back     alignment and structure
>pdb|4EHN|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|4EHH|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|2XYG|B Chain B, Caspase-3:cas329306 Length = 93 Back     alignment and structure
>pdb|1NME|B Chain B, Structure Of Casp-3 With Tethered Salicylate Length = 92 Back     alignment and structure
>pdb|2CJX|B Chain B, Extended Substrate Recognition In Caspase-3 Revealed By High Resolution X-ray Structure Analysis Length = 103 Back     alignment and structure
>pdb|2CJY|B Chain B, Extended Substrate Recognition In Caspase-3 Revealed By High Resolution X-Ray Structure Analysis Length = 103 Back     alignment and structure
>pdb|3EDQ|B Chain B, Crystal Structure Of Caspase-3 With Inhibitor Ac-Ldesd-Cho Length = 108 Back     alignment and structure
>pdb|2H5I|B Chain B, Crystal Structure Of Caspase-3 With Inhibitor Ac-Devd-Cho Length = 95 Back     alignment and structure
>pdb|2XZD|B Chain B, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 118 Back     alignment and structure
>pdb|1I3O|B Chain B, Crystal Structure Of The Complex Of Xiap-Bir2 And Caspase 3 Length = 110 Back     alignment and structure
>pdb|1PAU|B Chain B, Crystal Structure Of The Complex Of Apopain With The Tetrapeptide Aldehyde Inhibitor Ac-Devd-Cho Length = 102 Back     alignment and structure
>pdb|1GFW|B Chain B, The 2.8 Angstrom Crystal Structure Of Caspase-3 (Apopain Or Cpp32)in Complex With An Isatin Sulfonamide Inhibitor Length = 97 Back     alignment and structure
>pdb|3KJF|B Chain B, Caspase 3 Bound To A Covalent Inhibitor Length = 109 Back     alignment and structure
>pdb|3DEH|A Chain A, Crystal Structures Of Caspase-3 With Bound Isoquinoline-1,3, 4-Trione Derivative Inhibitors Length = 249 Back     alignment and structure
>pdb|3H0E|A Chain A, 3,4-Dihydropyrimido(1,2-A)indol-10(2h)-Ones As Potent Non- Peptidic Inhibitors Of Caspase-3 Length = 255 Back     alignment and structure
>pdb|4EHL|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|1CP3|A Chain A, Crystal Structure Of The Complex Of Apopain With The Tetrapeptide Inhibitor Ace-Dvad-Fmc Length = 277 Back     alignment and structure
>pdb|2J32|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of(Pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|2J31|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of(pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|4EHA|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|2J30|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of (Pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|3ITN|A Chain A, Crystal Structure Of Pseudo-Activated Procaspase-3 Length = 250 Back     alignment and structure
>pdb|1NMQ|A Chain A, Extendend Tethering: In Situ Assembly Of Inhibitors Length = 249 Back     alignment and structure
>pdb|1QX3|A Chain A, Conformational Restrictions In The Active Site Of Unliganded Human Caspase-3 Length = 257 Back     alignment and structure
>pdb|4EHF|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|3R5K|A Chain A, A Designed Redox-Controlled Caspase-7 Length = 312 Back     alignment and structure
>pdb|3PD0|A Chain A, Caspase-3 E246a Length = 250 Back     alignment and structure
>pdb|3PD1|A Chain A, Caspase-3 K242a Length = 250 Back     alignment and structure
>pdb|3PCX|A Chain A, Caspase-3 E246a, K242a Double Mutant Length = 250 Back     alignment and structure
>pdb|4FXO|A Chain A, Zinc-Mediated Allosteric Inhibiton Of Caspase-6 Length = 299 Back     alignment and structure
>pdb|2WDP|A Chain A, Crystal Structure Of Ligand Free Human Caspase-6 Length = 293 Back     alignment and structure
>pdb|4EJF|A Chain A, Allosteric Peptides That Bind To A Caspase Zymogen And Mediate Caspase Tetramerization Length = 279 Back     alignment and structure
>pdb|3NR2|A Chain A, Crystal Structure Of Caspase-6 Zymogen Length = 294 Back     alignment and structure
>pdb|3K7E|A Chain A, Crystal Structure Of Human Ligand-Free Mature Caspase-6 Length = 278 Back     alignment and structure
>pdb|3NKF|A Chain A, Crystal Structure Of Human Ligand-Free Mature Caspase-6 With Intersubunit Linker Attached Length = 277 Back     alignment and structure
>pdb|3S8E|A Chain A, Phosphorylation Regulates Assembly Of The Caspase-6 Substrate-Binding Groove Length = 277 Back     alignment and structure
>pdb|3V6M|A Chain A, Inhibition Of Caspase-6 Activity By Single Mutation Outside The Active Site Length = 279 Back     alignment and structure
>pdb|3V6L|A Chain A, Crystal Structure Of Caspase-6 Inactivation Mutation Length = 282 Back     alignment and structure
>pdb|3P4U|B Chain B, Crystal Structure Of Active Caspase-6 In Complex With Ac-Veid-Cho Inhibitor Length = 108 Back     alignment and structure
>pdb|3QNW|B Chain B, Caspase-6 In Complex With Z-Vad-Fmk Inhibitor Length = 100 Back     alignment and structure
>pdb|3P45|B Chain B, Crystal Structure Of Apo-Caspase-6 At Physiological Ph Length = 108 Back     alignment and structure
>pdb|2K7Z|A Chain A, Solution Structure Of The Catalytic Domain Of Procaspase-8 Length = 266 Back     alignment and structure
>pdb|2C2Z|B Chain B, Crystal Structure Of Caspase-8 In Complex With Aza-Peptide Michael Acceptor Inhibitor Length = 106 Back     alignment and structure
>pdb|3H11|B Chain B, Zymogen Caspase-8:c-Flipl Protease Domain Complex Length = 271 Back     alignment and structure
>pdb|2Y1L|B Chain B, Caspase-8 In Complex With Darpin-8.4 Length = 104 Back     alignment and structure
>pdb|1I4E|B Chain B, Crystal Structure Of The Caspase-8P35 COMPLEX Length = 258 Back     alignment and structure
>pdb|1QTN|B Chain B, Crystal Structure Of The Complex Of Caspase-8 With The Tetrapeptide Inhibitor Ace-Ietd-Aldehyde Length = 95 Back     alignment and structure
>pdb|1QDU|B Chain B, Crystal Structure Of The Complex Of Caspase-8 With The Tripeptide Ketone Inhibitor Zevd-Dcbmk Length = 88 Back     alignment and structure
>pdb|1F9E|B Chain B, Caspase-8 Specificity Probed At Subsite S4: Crystal Structure Of The Caspase-8-Z-Devd-Cho Length = 89 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
2ql9_B97 Caspase-7; cysteine protease, apoptosis, thiol pro 5e-18
2xzd_B118 Caspase-3; hydrolase-protein binding complex, de n 2e-17
2dko_B103 Caspase-3; low barrier hydrogen bond, caspase, dru 6e-17
1pyo_B105 Caspase-2; apoptosis, caspase, alpha-beta, thiol p 2e-16
3rjm_B117 Caspase-2; caspase-2, caspase, hydrolase-hydrolase 5e-16
1qtn_B95 Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst 2e-15
3sir_A259 Caspase; hydrolase; 2.68A {Drosophila melanogaster 2e-15
1m72_A272 Caspase-1; caspase, cysteine protease, hydrolase-h 2e-15
2nn3_C310 Caspase-1; cysteine protease, hydrolase; 3.00A {Sp 3e-15
1sc3_B88 Interleukin-1 beta convertase; malonate-bound casp 1e-14
4ehd_A277 Caspase-3; caspase, apoptosis, allosteric inhibiti 7e-14
3e4c_A302 Caspase-1; zymogen, inflammasome, ICE, IL-1B, inna 1e-13
1f1j_A305 Caspase-7 protease; caspase-7, cysteine protease, 3e-13
2j32_A250 Caspase-3; Pro-caspase3, thiol protease, hydrolase 5e-13
2fp3_A316 Caspase NC; apoptosis, initiator caspase activatio 1e-12
3od5_A278 Caspase-6; caspase domain, apoptotic protease, hyd 1e-12
3h11_A272 CAsp8 and FADD-like apoptosis regulator; cell deat 1e-11
1nw9_B277 Caspase 9, apoptosis-related cysteine protease; XI 2e-11
3h11_B271 Caspase-8; cell death, apoptosis, caspase, alterna 2e-09
>2ql9_B Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_B* 2ql5_B* 2qlb_B* 2qlf_B 2qlj_B* 3edr_B 3ibc_B 3ibf_B 1i51_B Length = 97 Back     alignment and structure
 Score = 70.6 bits (173), Expect = 5e-18
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 1/61 (1%)

Query: 26 FYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQ 85
          +YSWR P  G+WF+Q LC  L + G  L+++ I+TRV+ RVA   ES +D     H++KQ
Sbjct: 23 YYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSD-DPHFHEKKQ 81

Query: 86 I 86
          I
Sbjct: 82 I 82
>2xzd_B Caspase-3; hydrolase-protein binding complex, de novo protein, apoptosi ankyrin repeat protein, ribosome display; 2.10A {Homo sapiens} PDB: 2xzt_B 2y0b_B Length = 118 Back     alignment and structure
>2dko_B Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 2c2k_B* 2c2m_B* 2c2o_B* 2c1e_B* 2cdr_B* 2cnk_B* 2cnl_B* 2cnn_B* 2cno_B* 2cjy_B 1pau_B 1re1_B* 1rhk_B* 1rhm_B* 1rhq_B* 1rhr_B* 1rhu_B* 1rhj_B* 1i3o_B* 3edq_B ... Length = 103 Back     alignment and structure
>1pyo_B Caspase-2; apoptosis, caspase, alpha-beta, thiol protease, hydrolase-HY inhibitor complex; 1.65A {Homo sapiens} SCOP: c.17.1.1 PDB: 2p2c_B 3r5j_B 3r6g_B 3r7b_B 3r7n_B 3r7s_B 3r6l_B Length = 105 Back     alignment and structure
>3rjm_B Caspase-2; caspase-2, caspase, hydrolase-hydrolase inhibitor; HET: 3PX; 2.55A {Homo sapiens} Length = 117 Back     alignment and structure
>1qtn_B Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_B* 3kjq_B* 2y1l_B 1f9e_B* 1qdu_B* Length = 95 Back     alignment and structure
>3sir_A Caspase; hydrolase; 2.68A {Drosophila melanogaster} PDB: 3sip_A Length = 259 Back     alignment and structure
>1m72_A Caspase-1; caspase, cysteine protease, hydrolase-hydrolase inhibitor CO; 2.30A {Spodoptera frugiperda} SCOP: c.17.1.1 PDB: 3sip_B Length = 272 Back     alignment and structure
>2nn3_C Caspase-1; cysteine protease, hydrolase; 3.00A {Spodoptera frugiperda} Length = 310 Back     alignment and structure
>1sc3_B Interleukin-1 beta convertase; malonate-bound caspase-1, hydrolase; 1.80A {Homo sapiens} SCOP: c.17.1.1 PDB: 1ice_B 1bmq_B* 1rwm_B* 1rwk_B* 1rwo_B* 1rwp_B* 1rwv_B* 1rww_B* 1rwn_B* 1sc1_B 1rwx_B 1sc4_B 2h4y_B* 2hbq_B* 2hbr_B* 3ns7_B* 3d6f_B* 3d6h_B* 3d6m_B* 2h4w_B* ... Length = 88 Back     alignment and structure
>4ehd_A Caspase-3; caspase, apoptosis, allosteric inhibition; 1.58A {Homo sapiens} PDB: 4ehk_A 4ehf_A 4ehn_A 1cp3_A 4ehh_A 4eha_A 4ehl_A 1i3o_A Length = 277 Back     alignment and structure
>3e4c_A Caspase-1; zymogen, inflammasome, ICE, IL-1B, innate immunity, apoptosis, hydrolase, protease protease; 2.05A {Homo sapiens} Length = 302 Back     alignment and structure
>1f1j_A Caspase-7 protease; caspase-7, cysteine protease, hydrolase, apoptosis, hydrolas hydrolase inhibitor complex; 2.35A {Homo sapiens} SCOP: c.17.1.1 PDB: 1kmc_A 3r5k_A 1i4o_A 1gqf_A 3h1p_A 1shj_A* 1k86_A 1k88_A 1shl_A* Length = 305 Back     alignment and structure
>2j32_A Caspase-3; Pro-caspase3, thiol protease, hydrolase, hydrolase-hydrolase inhibitor complex; 1.30A {Homo sapiens} PDB: 2j30_A 3h0e_A* 2j33_A 3pd1_A 2j31_A 3pcx_A 1nms_A* 1nmq_A* 3deh_A* 3dei_A* 3dej_A* 3dek_A* 3pd0_A 3itn_A 1qx3_A Length = 250 Back     alignment and structure
>2fp3_A Caspase NC; apoptosis, initiator caspase activation, dimerization, active site conformation, hydrolysis/apoptosis complex; 2.50A {Drosophila melanogaster} Length = 316 Back     alignment and structure
>3od5_A Caspase-6; caspase domain, apoptotic protease, hydrolase-hydrolase INHI complex; 1.60A {Homo sapiens} PDB: 3k7e_A 3s70_A 3v6m_A 3v6l_A 3nr2_A 2wdp_A 3nkf_A 3s8e_A 3qnw_A* 3p4u_A* 3p45_B 3qnw_B* 3p4u_B* Length = 278 Back     alignment and structure
>3h11_A CAsp8 and FADD-like apoptosis regulator; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 3h13_A Length = 272 Back     alignment and structure
>1nw9_B Caspase 9, apoptosis-related cysteine protease; XIAP, caspase inhibition, caspase activation, dimerization; 2.40A {Homo sapiens} SCOP: c.17.1.1 PDB: 1jxq_A* 2ar9_A Length = 277 Back     alignment and structure
>3h11_B Caspase-8; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 2k7z_A 1i4e_B 2fun_B 2c2z_B* Length = 271 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
2ql9_B97 Caspase-7; cysteine protease, apoptosis, thiol pro 99.98
2dko_B103 Caspase-3; low barrier hydrogen bond, caspase, dru 99.98
2xzd_B118 Caspase-3; hydrolase-protein binding complex, de n 99.97
1pyo_B105 Caspase-2; apoptosis, caspase, alpha-beta, thiol p 99.97
3rjm_B117 Caspase-2; caspase-2, caspase, hydrolase-hydrolase 99.97
1qtn_B95 Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst 99.96
1sc3_B88 Interleukin-1 beta convertase; malonate-bound casp 99.96
3sir_A259 Caspase; hydrolase; 2.68A {Drosophila melanogaster 99.93
3od5_A278 Caspase-6; caspase domain, apoptotic protease, hyd 99.92
4ehd_A277 Caspase-3; caspase, apoptosis, allosteric inhibiti 99.92
1m72_A272 Caspase-1; caspase, cysteine protease, hydrolase-h 99.92
2nn3_C310 Caspase-1; cysteine protease, hydrolase; 3.00A {Sp 99.91
2j32_A250 Caspase-3; Pro-caspase3, thiol protease, hydrolase 99.91
1f1j_A305 Caspase-7 protease; caspase-7, cysteine protease, 99.89
1nw9_B277 Caspase 9, apoptosis-related cysteine protease; XI 99.89
3h11_B271 Caspase-8; cell death, apoptosis, caspase, alterna 99.87
2fp3_A316 Caspase NC; apoptosis, initiator caspase activatio 99.86
3h11_A272 CAsp8 and FADD-like apoptosis regulator; cell deat 99.86
3e4c_A302 Caspase-1; zymogen, inflammasome, ICE, IL-1B, inna 99.84
3uoa_B 390 Mucosa-associated lymphoid tissue lymphoma transl 99.54
>2ql9_B Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_B* 2ql5_B* 2qlb_B* 2qlf_B 2qlj_B* 3edr_B 3ibc_B 3ibf_B 1i51_B Back     alignment and structure
Probab=99.98  E-value=3.2e-33  Score=178.95  Aligned_cols=76  Identities=42%  Similarity=0.742  Sum_probs=69.7

Q ss_pred             cccCCCCCCccc----cCCCccccCCCCCchHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHhhhhccCCCccccccccC
Q psy13939         10 MYYKFDEEDDDD----VFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQ   85 (86)
Q Consensus        10 ~~~~iP~~aD~L----T~~g~~s~R~~~~GSwFIq~Lc~vl~~~~~~~dl~~ilt~Vn~~Va~~~~s~~~~~~~~~~~KQ   85 (86)
                      ..++||.+||||    |+|||+||||+..||||||+||++|++++++.||++|||+||++|+..|++.+.. +..+++||
T Consensus         3 ~~~~iP~~aDfL~~yST~pG~~S~R~~~~GSwfIq~Lc~~l~~~~~~~dl~~ilt~Vn~~V~~~~~~~~~~-~~~~~~kQ   81 (97)
T 2ql9_B            3 PRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDD-PHFHEKKQ   81 (97)
T ss_dssp             ---CBCTTTTEEEEESSCTTBCCEEETTTEEHHHHHHHHHHHHHTTTSCHHHHHHHHHHHHHHHCCCCCSS-GGGTTCBC
T ss_pred             CCcccCCCCCEEEEEeCCCCcEeeecCCCCCeeHHHHHHHHHHhCCCCcHHHHHHHHHHHHHHhhccccCC-cccCCceE
Confidence            567899999999    9999999999999999999999999999999999999999999999999988754 78899999


Q ss_pred             C
Q psy13939         86 I   86 (86)
Q Consensus        86 m   86 (86)
                      |
T Consensus        82 ~   82 (97)
T 2ql9_B           82 I   82 (97)
T ss_dssp             C
T ss_pred             e
Confidence            8
>2dko_B Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 2c2k_B* 2c2m_B* 2c2o_B* 2c1e_B* 2cdr_B* 2cnk_B* 2cnl_B* 2cnn_B* 2cno_B* 2cjy_B 1pau_B 1re1_B* 1rhk_B* 1rhm_B* 1rhq_B* 1rhr_B* 1rhu_B* 1rhj_B* 1i3o_B* 3edq_B ... Back     alignment and structure
>2xzd_B Caspase-3; hydrolase-protein binding complex, de novo protein, apoptosi ankyrin repeat protein, ribosome display; 2.10A {Homo sapiens} PDB: 2xzt_B 2y0b_B Back     alignment and structure
>1pyo_B Caspase-2; apoptosis, caspase, alpha-beta, thiol protease, hydrolase-HY inhibitor complex; 1.65A {Homo sapiens} SCOP: c.17.1.1 PDB: 2p2c_B 3r5j_B 3r6g_B 3r7b_B 3r7n_B 3r7s_B 3r6l_B Back     alignment and structure
>3rjm_B Caspase-2; caspase-2, caspase, hydrolase-hydrolase inhibitor; HET: 3PX; 2.55A {Homo sapiens} Back     alignment and structure
>1qtn_B Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_B* 3kjq_B* 2y1l_B 1f9e_B* 1qdu_B* Back     alignment and structure
>1sc3_B Interleukin-1 beta convertase; malonate-bound caspase-1, hydrolase; 1.80A {Homo sapiens} SCOP: c.17.1.1 PDB: 1ice_B 1bmq_B* 1rwm_B* 1rwk_B* 1rwo_B* 1rwp_B* 1rwv_B* 1rww_B* 1rwn_B* 1sc1_B 1rwx_B 1sc4_B 2h4y_B* 2hbq_B* 2hbr_B* 3ns7_B* 3d6f_B* 3d6h_B* 3d6m_B* 2h4w_B* ... Back     alignment and structure
>3sir_A Caspase; hydrolase; 2.68A {Drosophila melanogaster} PDB: 3sip_A Back     alignment and structure
>3od5_A Caspase-6; caspase domain, apoptotic protease, hydrolase-hydrolase INHI complex; 1.60A {Homo sapiens} SCOP: c.17.1.0 PDB: 3k7e_A 3s70_A 3v6m_A 3v6l_A 3nr2_A 4fxo_A 2wdp_A 3nkf_A 3s8e_A 4ejf_A 3qnw_A* 3p4u_A* 3p45_B 3qnw_B* 3p4u_B* Back     alignment and structure
>4ehd_A Caspase-3; caspase, apoptosis, allosteric inhibition; 1.58A {Homo sapiens} PDB: 4ehk_A 4ehf_A 4ehn_A 1cp3_A 4ehh_A 4eha_A 4ehl_A 1i3o_A Back     alignment and structure
>1m72_A Caspase-1; caspase, cysteine protease, hydrolase-hydrolase inhibitor CO; 2.30A {Spodoptera frugiperda} SCOP: c.17.1.1 PDB: 3sip_B Back     alignment and structure
>2nn3_C Caspase-1; cysteine protease, hydrolase; 3.00A {Spodoptera frugiperda} Back     alignment and structure
>2j32_A Caspase-3; Pro-caspase3, thiol protease, hydrolase, hydrolase-hydrolase inhibitor complex; 1.30A {Homo sapiens} PDB: 2j30_A 3h0e_A* 2j33_A 3pd1_A 2j31_A 3pcx_A 1nms_A* 1nmq_A* 3deh_A* 3dei_A* 3dej_A* 3dek_A* 3pd0_A 3itn_A 1qx3_A Back     alignment and structure
>1f1j_A Caspase-7 protease; caspase-7, cysteine protease, hydrolase, apoptosis, hydrolas hydrolase inhibitor complex; 2.35A {Homo sapiens} SCOP: c.17.1.1 PDB: 1kmc_A 3r5k_A 1i4o_A 1gqf_A 3h1p_A 1shj_A* 1k86_A 1k88_A 1shl_A* Back     alignment and structure
>1nw9_B Caspase 9, apoptosis-related cysteine protease; XIAP, caspase inhibition, caspase activation, dimerization; 2.40A {Homo sapiens} SCOP: c.17.1.1 PDB: 1jxq_A* 2ar9_A Back     alignment and structure
>3h11_B Caspase-8; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} SCOP: c.17.1.1 PDB: 2k7z_A 1i4e_B 2fun_B 2c2z_B* Back     alignment and structure
>2fp3_A Caspase NC; apoptosis, initiator caspase activation, dimerization, active site conformation, hydrolysis/apoptosis complex; 2.50A {Drosophila melanogaster} Back     alignment and structure
>3h11_A CAsp8 and FADD-like apoptosis regulator; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 3h13_A Back     alignment and structure
>3e4c_A Caspase-1; zymogen, inflammasome, ICE, IL-1B, innate immunity, apoptosis, hydrolase, protease protease; 2.05A {Homo sapiens} Back     alignment and structure
>3uoa_B Mucosa-associated lymphoid tissue lymphoma transl protein 1; paracaspase, lymphoma, NF-KB signalling, caspase fold, immun fold, hydrolase-hydrolase inhibitor complex; 1.75A {Homo sapiens} PDB: 3uo8_B 3v55_A 3v4l_A* 3v4o_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 86
d1m72a_256 c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera 3e-16
g1nme.1238 c.17.1.1 (A:,B:) Apopain (caspase-3, cpp32) {Human 5e-13
d1f1ja_245 c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [Tax 3e-12
g1pyo.1257 c.17.1.1 (A:,B:) Caspase-2 {Human (Homo sapiens) [ 6e-11
d1nw9b_277 c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [Tax 7e-11
g1sc3.1261 c.17.1.1 (A:,B:) Interleukin-1beta converting enzy 5e-09
g1qtn.1242 c.17.1.1 (A:,B:) Caspase-8 {Human (Homo sapiens) [ 3e-07
>d1m72a_ c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Caspase-like
superfamily: Caspase-like
family: Caspase catalytic domain
domain: Caspase-1
species: Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]

 Score = 68.2 bits (166), Expect = 3e-16
 Identities = 28/61 (45%), Positives = 44/61 (72%)

Query: 26  FYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQ 85
           ++SWR+   G+WF+Q LC+EL  +GT+ D+L+++T V ++VALD ES     +  HQQKQ
Sbjct: 181 YFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQ 240

Query: 86  I 86
           +
Sbjct: 241 V 241
>d1f1ja_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1nw9b_ c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
d1f1ja_245 Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1m72a_256 Caspase-1 {Fall armyworm (Spodoptera frugiperda) [ 99.82
g1nme.1238 Apopain (caspase-3, cpp32) {Human (Homo sapiens) [ 99.78
g1pyo.1257 Caspase-2 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1nw9b_277 Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} 99.63
g1qtn.1242 Caspase-8 {Human (Homo sapiens) [TaxId: 9606]} 99.6
g1sc3.1261 Interleukin-1beta converting enzyme (a cysteine pr 99.57
>d1f1ja_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Caspase-like
superfamily: Caspase-like
family: Caspase catalytic domain
domain: Caspase-7
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.82  E-value=5.1e-21  Score=134.61  Aligned_cols=76  Identities=42%  Similarity=0.742  Sum_probs=68.8

Q ss_pred             cccCCCCCCccc----cCCCccccCCCCCchHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHhhhhccCCCccccccccC
Q psy13939         10 MYYKFDEEDDDD----VFVSFYSWRHPENGTWFIQCLCQELADSGTKLDLLSIMTRVSRRVALDMESYNDLLSWQHQQKQ   85 (86)
Q Consensus        10 ~~~~iP~~aD~L----T~~g~~s~R~~~~GSwFIq~Lc~vl~~~~~~~dl~~ilt~Vn~~Va~~~~s~~~~~~~~~~~KQ   85 (86)
                      ....+|..+|+|    |.||++|||++..||||||+||++|.++++..+|++||++||++|+...++.... +..+++||
T Consensus       152 ~~~~~p~~~d~li~~st~~g~~a~~~~~~gS~fi~~L~~~l~~~~~~~~l~~il~~V~~~V~~~~~~~~~~-~~~~~~kQ  230 (245)
T d1f1ja_         152 PRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDD-PHFHEKKQ  230 (245)
T ss_dssp             ---CBCTTTTEEEEESSCTTBCCEEETTTEEHHHHHHHHHHHHHTTTSCHHHHHHHHHHHHHHHCCCCCSS-GGGSSCBC
T ss_pred             cccccCCCCCeEEEEecCCCceeccCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHhhccCCc-ccccCcee
Confidence            456789999999    9999999999999999999999999999999999999999999999888887766 78899999


Q ss_pred             C
Q psy13939         86 I   86 (86)
Q Consensus        86 m   86 (86)
                      |
T Consensus       231 ~  231 (245)
T d1f1ja_         231 I  231 (245)
T ss_dssp             C
T ss_pred             e
Confidence            7
>d1m72a_ c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Back     information, alignment and structure
>d1nw9b_ c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure