Diaphorina citri psyllid: psy13956


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MLKAQKRLGSRTAVVDNNSNTEKRRKNTRKPKTDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFARSG
ccEEcccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccc
********GSRTAVVDNNSNTE*****TRKPKTDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFARSG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKAQKRLGSRTAVVDNNSNTEKRRKNTRKPKTDQSVSGEEVPYFLGVPLDGDLSYYKSKYTTREKLHSEVILTWVSNFARSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0097090 [BP]presynaptic membrane organizationprobableGO:0016044, GO:0009987, GO:0016043, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0051960 [BP]regulation of nervous system developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0045202 [CC]synapseprobableGO:0005575
GO:0003674 [MF]molecular_functionprobable
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0071709 [BP]membrane assemblyprobableGO:0022607, GO:0016044, GO:0009987, GO:0016043, GO:0008150, GO:0061024, GO:0044085, GO:0044091, GO:0071840, GO:0044763, GO:0044699
GO:0051179 [BP]localizationprobableGO:0008150
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007416 [BP]synapse assemblyprobableGO:0032502, GO:0050808, GO:0044707, GO:0007399, GO:0032501, GO:0009987, GO:0048856, GO:0016043, GO:0008150, GO:0022607, GO:0044763, GO:0071840, GO:0048731, GO:0007275, GO:0044699, GO:0044085
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BIX, chain A
Confidence level:very confident
Coverage over the Query: 3-83
View the alignment between query and template
View the model in PyMOL