Diaphorina citri psyllid: psy13989


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MQNWKKVRKAFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWPTAGVKGLFSLIRAG
cccccEEEEcccccHHHcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccccccccc
MQNWKKVRKAFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWPTAGVKGLFSLI***
xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNWKKVRKAFMAPELLFGARMYGVGIDMWAVGCIICELLLKAPFLPGESDLDQLTRIFQTLGTPSEDTWPTAGVKGLFSLIRAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclin-dependent kinase 7 (Fragment) Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.confidentP51952
Cyclin-dependent kinase 7 Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.confidentP50613
Cyclin-dependent kinase 7 Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.confidentQ03147

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016301 [MF]kinase activityconfidentGO:0016772, GO:0016740, GO:0003674, GO:0003824
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008353 [MF]RNA polymerase II carboxy-terminal domain kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0008094 [MF]DNA-dependent ATPase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0004693 [MF]cyclin-dependent protein serine/threonine kinase activityprobableGO:0097472, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0007088 [BP]regulation of mitosisprobableGO:0007346, GO:0051726, GO:0033043, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051128, GO:0050789
GO:0006283 [BP]transcription-coupled nucleotide-excision repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006289, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0006370 [BP]7-methylguanosine mRNA cappingprobableGO:0036260, GO:0009452, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0048638 [BP]regulation of developmental growthprobableGO:0050793, GO:0008150, GO:0040008, GO:0065007, GO:0050789
GO:0014070 [BP]response to organic cyclic compoundprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0051301 [BP]cell divisionprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0006361 [BP]transcription initiation from RNA polymerase I promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006360, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0006363 [BP]termination of RNA polymerase I transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006360, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0006362 [BP]transcription elongation from RNA polymerase I promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006360, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0006367 [BP]transcription initiation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0030010 [BP]establishment of cell polarityprobableGO:0008150, GO:0009987, GO:0007163, GO:0044763, GO:0044699
GO:0070985 [CC]TFIIK complexprobableGO:0030880, GO:0044464, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0005675, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0000428, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0016604 [CC]nuclear bodyprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0001111 [BP]promoter clearance from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0001109, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0000086 [BP]G2/M transition of mitotic cell cycleprobableGO:0000278, GO:0008150, GO:0009987, GO:0044770, GO:0044772, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0000084 [BP]S phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0000080 [BP]G1 phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0051318, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0051050 [BP]positive regulation of transportprobableGO:0051049, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0050789
GO:0007224 [BP]smoothened signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0032880 [BP]regulation of protein localizationprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0043197 [CC]dendritic spineprobableGO:0044309, GO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0010243 [BP]response to organic nitrogenprobableGO:0009719, GO:0050896, GO:1901698, GO:0008150, GO:0042221, GO:0010033
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0070816 [BP]phosphorylation of RNA polymerase II C-terminal domainprobableGO:0080090, GO:0019222, GO:0016310, GO:0031323, GO:0050789, GO:0044267, GO:0044260, GO:0071704, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0031326, GO:0010468, GO:0006468, GO:0019219, GO:0009987, GO:0009889, GO:0006464, GO:0050794, GO:0043412, GO:0036211, GO:0008150, GO:0051171, GO:0008152, GO:2001141, GO:0044238, GO:0019538, GO:0051252, GO:0044237, GO:0043170, GO:0006355, GO:0006796, GO:0010556, GO:0006793
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0016032 [BP]viral reproductionprobableGO:0009987, GO:0044764, GO:0008150, GO:0051704
GO:0006368 [BP]transcription elongation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0000307 [CC]cyclin-dependent protein kinase holoenzyme complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0050434 [BP]positive regulation of viral transcriptionprobableGO:0009893, GO:0019222, GO:0031328, GO:2000243, GO:0031325, GO:2000241, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:0019219, GO:0065007, GO:0046782, GO:0031326, GO:0048518, GO:0045935, GO:0060255, GO:0050792, GO:0009889, GO:0050794, GO:0043902, GO:0043900, GO:0008150, GO:0051171, GO:2001141, GO:0051173, GO:0051252, GO:0051254, GO:0010557, GO:0010556, GO:0048524, GO:0048522
GO:0001558 [BP]regulation of cell growthprobableGO:0040008, GO:0050794, GO:0008150, GO:0065007, GO:0051128, GO:0050789
GO:1901700 [BP]response to oxygen-containing compoundprobableGO:0042221, GO:0050896, GO:0008150
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0006996 [BP]organelle organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0009628 [BP]response to abiotic stimulusprobableGO:0050896, GO:0008150
GO:0007050 [BP]cell cycle arrestprobableGO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0000079 [BP]regulation of cyclin-dependent protein serine/threonine kinase activityprobableGO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0071900, GO:0050789, GO:0043549, GO:0051246, GO:0065007, GO:0031399, GO:0065009, GO:0045859, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0032268, GO:0051726, GO:0051338, GO:0001932
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0004712 [MF]protein serine/threonine/tyrosine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0000718 [BP]nucleotide-excision repair, DNA damage removalprobableGO:0044238, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0044349, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0006308, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0051716, GO:0046700, GO:0006974, GO:0006259, GO:0006950, GO:0008150, GO:0008152, GO:0034655, GO:0006289, GO:0009056, GO:0009057, GO:0046483, GO:0044248, GO:0044270, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0019439, GO:0044763
GO:0009607 [BP]response to biotic stimulusprobableGO:0050896, GO:0008150
GO:0060341 [BP]regulation of cellular localizationprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789, GO:0050794
GO:0009299 [BP]mRNA transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005815 [CC]microtubule organizing centerprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0022604 [BP]regulation of cell morphogenesisprobableGO:0022603, GO:0050793, GO:0050794, GO:0065007, GO:0008150, GO:0051128, GO:0050789
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0032806 [CC]carboxy-terminal domain protein kinase complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0034613 [BP]cellular protein localizationprobableGO:0008104, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0050684 [BP]regulation of mRNA processingprobableGO:0080090, GO:0019222, GO:0060255, GO:0051252, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0010468
GO:0051130 [BP]positive regulation of cellular component organizationprobableGO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0048156 [MF]tau protein bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0030427 [CC]site of polarized growthprobableGO:0005575, GO:0044464, GO:0005623
GO:0009725 [BP]response to hormone stimulusprobableGO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UA2, chain A
Confidence level:very confident
Coverage over the Query: 4-71
View the alignment between query and template
View the model in PyMOL