Diaphorina citri psyllid: psy14005

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------

MKKKKKKQERSELKPDESYPHDLSGNINRVHLIPFVDFQVPAENFDSVTIYFSDIVGFTNISADSSPMEVVNMLNTLYKLFDSRIRKYDVYKVETIGDAYMVVSGLPQRNGKSPGTAISFYIRNIGSFGGLGTKGFFRPFSGTLHVGEIATMSLDLLVGIEHFKIPHRPNDKLEIRVGINTGPCVAGVVGTTMPRYCLFGDTINTASRMESAGDLPSFFIVTIVMR

cHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccccEEEEEEccccHHHHHcccccHHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEEEcccccccccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccccccccccccccccccccHHHHHHHHccccccccEEEEccccc

**KKK*KQERSELKPDESYPHDLSGNINRVHLIPFVDFQVPAENFDSVTIYFSDIVGFTNISADSSPMEVVNMLNTLYKLFDSRIRKYDVYKVETIGDAYMVVSGLPQRNGKSPGTAISFYIRNIGSFGGLGTKGFFRPFSGTLHVGEIATMSLDLLVGIEHFKIPHRPNDKLEIRVGINTGPCVAGVVGTTMPRYCLFGDTINTASRMESAGDLPSFFIVTI***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Atrial natriuretic peptide receptor 1	Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.	confident	P16066
Atrial natriuretic peptide receptor 1	Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.	confident	P18293
Atrial natriuretic peptide receptor 1	Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.	confident	P18910

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0015643 [MF]	toxic substance binding	probable	GO:0003674, GO:0005488
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0052652 [BP]	cyclic purine nucleotide metabolic process	probable	GO:0009187, GO:0044249, GO:0034641, GO:0009165, GO:0044281, GO:0072521, GO:0072522, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0008150, GO:0071704, GO:0009190, GO:0018130, GO:0006793, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:0044237, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753
GO:0050794 [BP]	regulation of cellular process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0050896 [BP]	response to stimulus	probable	GO:0008150
GO:0009152 [BP]	purine ribonucleotide biosynthetic process	probable	GO:0044249, GO:0034641, GO:0009165, GO:0044237, GO:0072521, GO:0072522, GO:1901362, GO:0009259, GO:1901360, GO:1901576, GO:0044710, GO:0008150, GO:0071704, GO:0018130, GO:0009987, GO:0006139, GO:0006793, GO:0006725, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:0044281

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UVJ, chain A
Confidence level:very confident
Coverage over the Query: 38-111,144-226
View the alignment between query and template
View the model in PyMOL

Template: 1FX4, chain A
Confidence level:probable
Coverage over the Query: 40-214
View the alignment between query and template
View the model in PyMOL