Diaphorina citri psyllid: psy14007


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
NERLLIHWAALSGREDVVDFLLKNKSPVDPKDDTNRTPLILAAAAGKLEIVRLLISNGADVNAKADGGHSALQYACSKGWKEIAELLIHNHANVNIQDVRGATPLHRAASQGITPVVKLLLTQRLDIDVNITDAYGNTPLHYACEEKRLTDAKLLVRCGARLDIQNKEKKTPLDLLPLPHLAQALTEIEPIVGDLPED
ccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHcccccHHHHHHHHHHccccccc
NERLLIHWAALSGREDVVDFLLKNKSPVDPKDDTNRTPLILAAAAGKLEIVRLLISNGADVNAKADGGHSALQYACSKGWKEIAELLIHNHANVNIQDVRGATPLHRAASQGITPVVKLLLTQRLDIDVNITDAYGNTPLHYACEEKRLTDAKLLVRCGARLDIQNKEKKTPLDLLPLPHLAQALTEIEPIVG*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NERLLIHWAALSGREDVVDFLLKNKSPVDPKDDTNRTPLILAAAAGKLEIVRLLISNGADVNAKADGGHSALQYACSKGWKEIAELLIHNHANVNIQDVRGATPLHRAASQGITPVVKLLLTQRLDIDVNITDAYGNTPLHYACEEKRLTDAKLLVRCGARLDIQNKEKKTPLDLLPLPHLAQALTEIEPIVGDLPED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
26S proteasome non-ATPase regulatory subunit 10 Acts as a chaperone during the assembly of the 26S proteasome, specifically of the 19S regulatory complex (RC).confidentQ54HW1
26S proteasome non-ATPase regulatory subunit 10 Acts as an oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4. Facilitates binding of MDM2 to p53/TP53 and the mono- and polyubiquitination of p53/TP53 by MDM2 suggesting a function in targeting the TP53:MDM2 complex to the 26S proteasome. Involved in p53-independent apoptosis. Involved in regulation of NF-kappa-B by retaining it in the cytoplasm. Binds to the NF-kappa-B component RELA and accelerates its XPO1/CRM1-mediated nuclear export.confidentQ9Z2X2
26S proteasome non-ATPase regulatory subunit 10 Acts as an oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4. Facilitates binding of MDM2 to p53/TP53 and the mono- and polyubiquitination of p53/TP53 by MDM2 suggesting a function in targeting the TP53:MDM2 complex to the 26S proteasome. Involved in p53-independent apoptosis. Involved in regulation of NF-kappa-B by retaining it in the cytoplasm. Binds to the NF-kappa-B component RELA and accelerates its XPO1/CRM1-mediated nuclear export.confidentQ9Z2X3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031398 [BP]positive regulation of protein ubiquitinationprobableGO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0004672 [MF]protein kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042383 [CC]sarcolemmaprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886
GO:0045737 [BP]positive regulation of cyclin-dependent protein kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0071902, GO:0071900, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0045787, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0010604, GO:0042325, GO:0042327, GO:0045860, GO:0051726, GO:0000079, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0033267 [CC]axon partprobableGO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0006464 [BP]cellular protein modification processprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0030307 [BP]positive regulation of cell growthprobableGO:0045927, GO:0040008, GO:0051128, GO:0001558, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0032088 [BP]negative regulation of NF-kappaB transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044092, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0043433, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0043409 [BP]negative regulation of MAPK cascadeprobableGO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0050789, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0010627, GO:0010741, GO:0048523, GO:0043408
GO:0045111 [CC]intermediate filament cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0008540 [CC]proteasome regulatory particle, base subcomplexprobableGO:0043234, GO:0005838, GO:0022624, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0000502, GO:0044424, GO:0032991
GO:0007253 [BP]cytoplasmic sequestering of NF-kappaBprobableGO:0033157, GO:0008104, GO:0060341, GO:0051049, GO:0048585, GO:0032387, GO:0048583, GO:0023057, GO:0051224, GO:0010648, GO:0023051, GO:0051220, GO:0051223, GO:0010627, GO:0051235, GO:0044699, GO:0032880, GO:0010646, GO:0009968, GO:0070727, GO:0009966, GO:0051651, GO:0050789, GO:0065007, GO:0043124, GO:0048519, GO:0065008, GO:0010741, GO:0043122, GO:0070201, GO:0009987, GO:0032507, GO:0051051, GO:0034613, GO:0090317, GO:0050794, GO:0045185, GO:0032386, GO:0044763, GO:0042308, GO:0042306, GO:0042994, GO:0032879, GO:0042992, GO:0051179, GO:0042990, GO:0051641, GO:1900180, GO:0033036, GO:0042347, GO:0042345, GO:0046822, GO:0046823, GO:0008150, GO:0048523
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043518 [BP]negative regulation of DNA damage response, signal transduction by p53 class mediatorprobableGO:0010646, GO:0009968, GO:0023057, GO:0009966, GO:0050789, GO:0048585, GO:0080135, GO:0048583, GO:0050794, GO:0023051, GO:2001021, GO:0065007, GO:0048519, GO:0008150, GO:1901796, GO:1901797, GO:2001020, GO:0043516, GO:0080134, GO:0048523, GO:0010648
GO:0045202 [CC]synapseprobableGO:0005575
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0090201 [BP]negative regulation of release of cytochrome c from mitochondriaprobableGO:2001233, GO:0048583, GO:0051129, GO:0051128, GO:0010821, GO:0010823, GO:0023051, GO:0010941, GO:0042981, GO:0050789, GO:0044699, GO:0010646, GO:0009966, GO:0033043, GO:0043067, GO:0065007, GO:0048519, GO:0090199, GO:0009987, GO:0050794, GO:0044763, GO:0010639, GO:0008150, GO:0048523
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0016409 [MF]palmitoyltransferase activityprobableGO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674
GO:0031674 [CC]I bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0070682 [BP]proteasome regulatory particle assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0043248, GO:0034622, GO:0043623, GO:0071840
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 3-196
View the alignment between query and template
View the model in PyMOL