Diaphorina citri psyllid: psy14016


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-
MSDVQWPWQYNFPPFFTLQPNEETRKKQLEAWRDLVLEYHKKTKTCIIDIQEADNTALFFNPAISSILYAH
cccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccccccccccccccccccc
*SDVQWPWQYNFPPFFTLQPNEETRKKQLEAWRDLVLEYHKKTKTCIIDIQEADNTALFFNPAISSILY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDVQWPWQYNFPPFFTLQPNEETRKKQLEAWRDLVLEYHKKTKTCIIDIQEADNTALFFNPAISSILYAH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein-sorting-associated protein 25 Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex.confidentQ6NWF4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010797 [BP]regulation of multivesicular body size involved in endosome transportprobableGO:0016197, GO:0051234, GO:0006810, GO:0046907, GO:0071840, GO:0032509, GO:0016043, GO:0090066, GO:0010796, GO:0044765, GO:0065007, GO:0044763, GO:0044699, GO:0051036, GO:0008150, GO:0009987, GO:0065008, GO:0051649, GO:0051179, GO:0032535, GO:0051641
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CUQ, chain C
Confidence level:very confident
Coverage over the Query: 3-71
View the alignment between query and template
View the model in PyMOL