Diaphorina citri psyllid: psy14029


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MKAVNNKWRYYSGLPHADPVVADLLIDMMGVLASYSITVKELKLFFAAMKAVNNKWPRHSTKLLNVLRQMPQRNGPDVFFSFPGKKGSAMVLPPLAKWPHENGFTFTTWFRLDPINSVNIEREKPYLYSFKTSKGVGYTAHFVGNCLVLTSMKIKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCFVNGQLASSTEMAWFVSTNEPFDKCYIGATPELDEERVFCGQMAAIYLFNESLSTHQICAMHRLGPGYKVKTGWVEELNSSWGEEL
ccHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccccEEEECccccccEEEccccccccccccEEEEEEEEEcccccccccccccEEEEEEcccccEEEEEEEcccEEEEEEEEcccEEEEEEEECccccCEEEEEEEEEcccccccEEEEEEccEEEEEEEEEccccccccccCEEECccccccccccEEEEccEEEEEcccccHHHHHHHHHccccccccccccccccccccccc
*****NKWRYYSGLPHADPVVADLLIDMMGVLASYSITVKELKLFFAAMKAVNNKWPRHSTKLLNVLRQMPQRNGPDVFFSFPGKKGSAMVLPPLAKWPHENGFTFTTWFRLDPINSVNIEREKPYLYSFKTSKGVGYTAHFVGNCLVLTSMKIKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCFVNGQLASSTEMAWFVSTNEPFDKCYIGATPELDEERVFCGQMAAIYLFNESLSTHQICAMHRLGPGYKVKTGWVEEL********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAVNNKWRYYSGLPHADPVVADLLIDMMGVLASYSITVKELKLFFAAMKAVNNKWPRHSTKLLNVLRQMPQRNGPDVFFSFPGKKGSAMVLPPLAKWPHENGFTFTTWFRLDPINSVNIEREKPYLYSFKTSKGVGYTAHFVGNCLVLTSMKIKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCFVNGQLASSTEMAWFVSTNEPFDKCYIGATPELDEERVFCGQMAAIYLFNESLSTHQICAMHRLGPGYKVKTGWVEELNSSWGEEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Neurobeachin Binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. May anchor the kinase to cytoskeletal and/or organelle-associated proteins. Required for correct retinal pattern formation and may function in cell fate determination through its interactions with the EGFR and Notch signaling pathways.very confidentQ9W4E2
Neurobeachin Binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. May anchor the kinase to cytoskeletal and/or organelle-associated proteins. May have a role in membrane trafficking.confidentQ9EPN1
Neurobeachin Binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. May anchor the kinase to cytoskeletal and/or organelle-associated proteins.confidentQ8NFP9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016021 [CC]integral to membraneconfidentGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043025 [CC]neuronal cell bodyconfidentGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007528 [BP]neuromuscular junction developmentprobableGO:0050808, GO:0030154, GO:0048468, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0071840, GO:0007517, GO:0048869, GO:0007519, GO:0016043, GO:0048513, GO:0044699, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0048741, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0016319 [BP]mushroom body developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0008355 [BP]olfactory learningprobableGO:0032501, GO:0007635, GO:0044707, GO:0042048, GO:0044708, GO:0050896, GO:0007612, GO:0007610, GO:0007611, GO:0008306, GO:0008150, GO:0050890, GO:0050877, GO:0042221, GO:0044699, GO:0003008
GO:0042675 [BP]compound eye cone cell differentiationprobableGO:0048749, GO:0032502, GO:0009887, GO:0009653, GO:0044707, GO:0007423, GO:0048869, GO:0048592, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0001654, GO:0009987, GO:0001745, GO:0032501, GO:0007275, GO:0044699, GO:0048856
GO:0008104 [BP]protein localizationprobableGO:0033036, GO:0008150, GO:0051179
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FLP, chain A
Confidence level:confident
Coverage over the Query: 80-256
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1epw, chain A confident Alignment | Template Structure